DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7637 and NOP10

DIOPT Version :9

Sequence 1:NP_610610.1 Gene:CG7637 / 36135 FlyBaseID:FBgn0033548 Length:64 Species:Drosophila melanogaster
Sequence 2:NP_058135.1 Gene:NOP10 / 856471 SGDID:S000007455 Length:58 Species:Saccharomyces cerevisiae


Alignment Length:55 Identity:39/55 - (70%)
Similarity:47/55 - (85%) Gaps:0/55 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MYLMYTINENGDRVYTLKKRTEDGRPTLSAHPARFSPEDKYSRQRLTIKKRFGLL 55
            |:||||:..:|.|:|||||.||.|..|.|||||||||:|||||||:|:||||||:
Yeast     1 MHLMYTLGPDGKRIYTLKKVTESGEITKSAHPARFSPDDKYSRQRVTLKKRFGLV 55

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7637NP_610610.1 Nop10p 4..52 CDD:398004 33/47 (70%)
NOP10NP_058135.1 Nop10p 4..52 CDD:398004 33/47 (70%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345378
Domainoid 1 1.000 79 1.000 Domainoid score I2052
eggNOG 1 0.900 - - E1_COG2260
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 86 1.000 Inparanoid score I1583
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53713
OrthoFinder 1 1.000 - - FOG0005085
OrthoInspector 1 1.000 - - oto99219
orthoMCL 1 0.900 - - OOG6_102021
Panther 1 1.100 - - LDO PTHR13305
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R826
SonicParanoid 1 1.000 - - X3606
TreeFam 1 0.960 - -
1413.790

Return to query results.
Submit another query.