DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nop10 and NOP10

DIOPT Version :10

Sequence 1:NP_610610.1 Gene:Nop10 / 36135 FlyBaseID:FBgn0033548 Length:64 Species:Drosophila melanogaster
Sequence 2:NP_058135.1 Gene:NOP10 / 856471 SGDID:S000007455 Length:58 Species:Saccharomyces cerevisiae


Alignment Length:55 Identity:39/55 - (70%)
Similarity:47/55 - (85%) Gaps:0/55 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MYLMYTINENGDRVYTLKKRTEDGRPTLSAHPARFSPEDKYSRQRLTIKKRFGLL 55
            |:||||:..:|.|:|||||.||.|..|.|||||||||:|||||||:|:||||||:
Yeast     1 MHLMYTLGPDGKRIYTLKKVTESGEITKSAHPARFSPDDKYSRQRVTLKKRFGLV 55

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nop10NP_610610.1 Nop10p 4..52 CDD:427735 33/47 (70%)
NOP10NP_058135.1 Nop10p 4..52 CDD:427735 33/47 (70%)

Return to query results.
Submit another query.