DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nop10 and NOP10

DIOPT Version :10

Sequence 1:NP_610610.1 Gene:Nop10 / 36135 FlyBaseID:FBgn0033548 Length:64 Species:Drosophila melanogaster
Sequence 2:NP_565472.1 Gene:NOP10 / 816569 AraportID:AT2G20490 Length:64 Species:Arabidopsis thaliana


Alignment Length:58 Identity:38/58 - (65%)
Similarity:45/58 - (77%) Gaps:0/58 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MYLMYTINENGDRVYTLKKRTEDGRPTLSAHPARFSPEDKYSRQRLTIKKRFGLLLTQ 58
            |||...|||.|::|||.||.:..|..|.|||||||||:||||:||:.:|||||||.||
plant     1 MYLQCYINEKGEKVYTTKKESPLGLATESAHPARFSPDDKYSKQRVLLKKRFGLLPTQ 58

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nop10NP_610610.1 Nop10p 4..52 CDD:427735 28/47 (60%)
NOP10NP_565472.1 Nop10p 6..52 CDD:427735 28/45 (62%)

Return to query results.
Submit another query.