DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nop10 and Nop10

DIOPT Version :10

Sequence 1:NP_610610.1 Gene:Nop10 / 36135 FlyBaseID:FBgn0033548 Length:64 Species:Drosophila melanogaster
Sequence 2:NP_079679.1 Gene:Nop10 / 66181 MGIID:1913431 Length:64 Species:Mus musculus


Alignment Length:63 Identity:42/63 - (66%)
Similarity:51/63 - (80%) Gaps:0/63 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MYLMYTINENGDRVYTLKKRTEDGRPTLSAHPARFSPEDKYSRQRLTIKKRFGLLLTQKPEPI 63
            |:|.|.:||.|||||||||....|:.|.|||||||||:|||||.|:||||||.:|:||:|.|:
Mouse     1 MFLQYYLNEQGDRVYTLKKFDPMGQQTCSAHPARFSPDDKYSRHRITIKKRFKVLMTQQPRPV 63

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nop10NP_610610.1 Nop10p 4..52 CDD:427735 33/47 (70%)
Nop10NP_079679.1 Nop10p 4..52 CDD:427735 33/47 (70%)

Return to query results.
Submit another query.