DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7637 and NOP10

DIOPT Version :9

Sequence 1:NP_610610.1 Gene:CG7637 / 36135 FlyBaseID:FBgn0033548 Length:64 Species:Drosophila melanogaster
Sequence 2:NP_061118.1 Gene:NOP10 / 55505 HGNCID:14378 Length:64 Species:Homo sapiens


Alignment Length:63 Identity:42/63 - (66%)
Similarity:51/63 - (80%) Gaps:0/63 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MYLMYTINENGDRVYTLKKRTEDGRPTLSAHPARFSPEDKYSRQRLTIKKRFGLLLTQKPEPI 63
            |:|.|.:||.|||||||||....|:.|.|||||||||:|||||.|:||||||.:|:||:|.|:
Human     1 MFLQYYLNEQGDRVYTLKKFDPMGQQTCSAHPARFSPDDKYSRHRITIKKRFKVLMTQQPRPV 63

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7637NP_610610.1 Nop10p 4..52 CDD:398004 33/47 (70%)
NOP10NP_061118.1 Nop10p 4..52 CDD:398004 33/47 (70%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165155531
Domainoid 1 1.000 76 1.000 Domainoid score I8999
eggNOG 1 0.900 - - E1_COG2260
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H41277
Inparanoid 1 1.050 92 1.000 Inparanoid score I5091
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53713
OrthoDB 1 1.010 - - D1628018at2759
OrthoFinder 1 1.000 - - FOG0005085
OrthoInspector 1 1.000 - - oto88996
orthoMCL 1 0.900 - - OOG6_102021
Panther 1 1.100 - - LDO PTHR13305
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R826
SonicParanoid 1 1.000 - - X3606
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.