DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7637 and nop10

DIOPT Version :9

Sequence 1:NP_610610.1 Gene:CG7637 / 36135 FlyBaseID:FBgn0033548 Length:64 Species:Drosophila melanogaster
Sequence 2:NP_001016163.1 Gene:nop10 / 548917 XenbaseID:XB-GENE-1001719 Length:64 Species:Xenopus tropicalis


Alignment Length:63 Identity:41/63 - (65%)
Similarity:55/63 - (87%) Gaps:0/63 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MYLMYTINENGDRVYTLKKRTEDGRPTLSAHPARFSPEDKYSRQRLTIKKRFGLLLTQKPEPI 63
            |:|.:.:||.|:||||:||.:.||:||.|||||||||:||:||.|:::||||||||||:|.|:
 Frog     1 MFLQFYLNEQGERVYTMKKVSPDGQPTTSAHPARFSPDDKFSRHRVSLKKRFGLLLTQQPRPV 63

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7637NP_610610.1 Nop10p 4..52 CDD:398004 29/47 (62%)
nop10NP_001016163.1 Nop10p 6..51 CDD:377228 28/44 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 76 1.000 Domainoid score I8851
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H41277
Inparanoid 1 1.050 96 1.000 Inparanoid score I4914
OMA 1 1.010 - - QHG53713
OrthoDB 1 1.010 - - D1628018at2759
OrthoFinder 1 1.000 - - FOG0005085
OrthoInspector 1 1.000 - - oto102862
Panther 1 1.100 - - LDO PTHR13305
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R826
SonicParanoid 1 1.000 - - X3606
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1212.110

Return to query results.
Submit another query.