DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7637 and nop10

DIOPT Version :9

Sequence 1:NP_610610.1 Gene:CG7637 / 36135 FlyBaseID:FBgn0033548 Length:64 Species:Drosophila melanogaster
Sequence 2:NP_001003868.1 Gene:nop10 / 445391 ZFINID:ZDB-GENE-041007-4 Length:64 Species:Danio rerio


Alignment Length:63 Identity:44/63 - (69%)
Similarity:54/63 - (85%) Gaps:0/63 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MYLMYTINENGDRVYTLKKRTEDGRPTLSAHPARFSPEDKYSRQRLTIKKRFGLLLTQKPEPI 63
            |:|.:.:||||:|||||||....|:||.|||||||||:||:||.|:||||||||||||:|.|:
Zfish     1 MFLQFYLNENGERVYTLKKVDPSGQPTSSAHPARFSPDDKFSRHRVTIKKRFGLLLTQQPRPV 63

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7637NP_610610.1 Nop10p 4..52 CDD:398004 32/47 (68%)
nop10NP_001003868.1 Nop10p 6..52 CDD:309313 32/45 (71%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 19..40 13/20 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170590693
Domainoid 1 1.000 77 1.000 Domainoid score I8832
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H41277
Inparanoid 1 1.050 98 1.000 Inparanoid score I5020
OMA 1 1.010 - - QHG53713
OrthoDB 1 1.010 - - D1628018at2759
OrthoFinder 1 1.000 - - FOG0005085
OrthoInspector 1 1.000 - - oto41422
orthoMCL 1 0.900 - - OOG6_102021
Panther 1 1.100 - - LDO PTHR13305
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R826
SonicParanoid 1 1.000 - - X3606
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1413.940

Return to query results.
Submit another query.