DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7637 and nola-3

DIOPT Version :9

Sequence 1:NP_610610.1 Gene:CG7637 / 36135 FlyBaseID:FBgn0033548 Length:64 Species:Drosophila melanogaster
Sequence 2:NP_492679.1 Gene:nola-3 / 172883 WormBaseID:WBGene00007708 Length:64 Species:Caenorhabditis elegans


Alignment Length:63 Identity:38/63 - (60%)
Similarity:47/63 - (74%) Gaps:0/63 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MYLMYTINENGDRVYTLKKRTEDGRPTLSAHPARFSPEDKYSRQRLTIKKRFGLLLTQKPEPI 63
            |:|.|.::||..||||||:....|..||:|||||||||||.|:.|:.||||||||.|||.:.:
 Worm     1 MFLRYFLDENQQRVYTLKRTAPSGEQTLTAHPARFSPEDKNSKYRIIIKKRFGLLPTQKAKTV 63

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7637NP_610610.1 Nop10p 4..52 CDD:398004 28/47 (60%)
nola-3NP_492679.1 Nop10p 13..52 CDD:282048 25/38 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160164096
Domainoid 1 1.000 66 1.000 Domainoid score I6561
eggNOG 1 0.900 - - E1_COG2260
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 80 1.000 Inparanoid score I3799
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53713
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005085
OrthoInspector 1 1.000 - - oto20092
orthoMCL 1 0.900 - - OOG6_102021
Panther 1 1.100 - - LDO PTHR13305
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R826
SonicParanoid 1 1.000 - - X3606
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.790

Return to query results.
Submit another query.