DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33144 and CUL7

DIOPT Version :9

Sequence 1:NP_001188904.1 Gene:CG33144 / 36131 FlyBaseID:FBgn0053144 Length:1102 Species:Drosophila melanogaster
Sequence 2:XP_016867022.1 Gene:CUL7 / 9820 HGNCID:21024 Length:1795 Species:Homo sapiens


Alignment Length:286 Identity:69/286 - (24%)
Similarity:99/286 - (34%) Gaps:102/286 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   527 SIVQYTGLRKCETVLALTRQSQSHGHVHGLS----QSR-SQG---HSLAVHGSGIFSSGGVEQIR 583
            ||...||:.|...||.|.        :|.||    |.| |.|   .:|:.|.:|....|  |:.:
Human   201 SIEPLTGVFKDPRVLDLL--------MHMLSSPDYQIRWSAGRMIQALSSHDAGEGQCG--EEGK 255

  Fly   584 P---LNRLRNSVSSINGVGTC--SRCSSLLSLAASGSRYSLSNGFAPRPTSALNHLEAGWEDDQR 643
            .   |.|||:|..::.|....  :|...||||:                              |:
Human   256 AGEGLGRLRDSQDTVAGASDLIRTRTQILLSLS------------------------------QQ 290

  Fly   644 RAQEPHINVN---AQIRLSGGATANS--------TSPSPPSNVTTAT----LHSSS----ANNLN 689
            .|.|.|::.:   |.:.|...||.:.        ..|..|..|..:.    ||.:|    .|:..
Human   291 EAIEKHLDFDSRCALLALFAQATLSEHPMSFEGIQLPQVPGRVLFSLVKRYLHVTSLLDQLNDSA 355

  Fly   690 QEP-QQSTSTPATTPTETPGSGELGPFGTNHAYPL--TVSSLLSMASANQAAQACCVRDGIALKR 751
            .|| .|:||.|...      |||.|......:..:  .:|.|:.....:||:.          :.
Human   356 AEPGAQNTSAPEEL------SGERGQLELEFSMAMGTLISELVQAMRWDQASD----------RP 404

  Fly   752 REMLAS---------ADVTPSVGTPA 768
            |....|         |||:|  |.||
Human   405 RSSARSPGSIFQPQLADVSP--GLPA 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33144NP_001188904.1 IBR 850..956 CDD:214763
IBR <976..1014 CDD:279784
CUL7XP_016867022.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469819at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.