DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33144 and ARI8

DIOPT Version :9

Sequence 1:NP_001188904.1 Gene:CG33144 / 36131 FlyBaseID:FBgn0053144 Length:1102 Species:Drosophila melanogaster
Sequence 2:NP_176722.2 Gene:ARI8 / 842854 AraportID:AT1G65430 Length:567 Species:Arabidopsis thaliana


Alignment Length:307 Identity:72/307 - (23%)
Similarity:112/307 - (36%) Gaps:73/307 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   725 VSSLLSMASANQAAQACCVRDGIALKRREMLAS-------AD---VTPSVGTPATPTTAFK---P 776
            :|::||: |.|.:|        |.|:......|       ||   |..:||....|...|.   .
plant    70 ISTVLSI-SRNSSA--------ILLRHYNWCVSRVHDEWFADEEKVRDAVGLLEKPVVDFPTDGE 125

  Fly   777 FTCKLCLIDVEDVGEAMALQQCGCQFCIECMRAYVEFEISE--GAYEISCPDATCPAQGAISLPE 839
            ..|.:|....  :.:.:....||..||..|...|:...|::  |...:.|||.:|.|  |:....
plant   126 LDCGICFETF--LSDKLHAAACGHPFCDSCWEGYITTAINDGPGCLTLRCPDPSCRA--AVGQDM 186

  Fly   840 IANLTTTNLLKKHHRYRLNREIELDKTRTWCPRAGCETICTVGAAAQPGQSSVICQMDESPSTSQ 904
            |..|......:|:..|.:...:|.::...|||..||:.....                       
plant   187 INLLAPDKDKQKYTSYFVRSYVEDNRKTKWCPAPGCDYAVNF----------------------- 228

  Fly   905 SYSPQQEVAGNGSTGAAAGNGAPVLSVSVHCPSCKDEFCGLCKKAYHPNISCDEFGRRLIADGQD 969
                   |.|:|             :..|:|..|. .||..|.:..|..:.||...:.::.:..:
plant   229 -------VVGSG-------------NYDVNCRCCY-SFCWNCAEEAHRPVDCDTVSKWVLKNSAE 272

  Fly   970 DIGIPFDNELIKCCPMCAVPIEKDEGCAQMMC-KRCKHVFCWYCLAS 1015
            ...:.:.....|.||.|..||||::||..:.| ..||..|||.||.:
plant   273 SENMNWILANSKPCPKCKRPIEKNQGCMHITCTPPCKFEFCWLCLGA 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33144NP_001188904.1 IBR 850..956 CDD:214763 18/105 (17%)
IBR <976..1014 CDD:279784 17/38 (45%)
ARI8NP_176722.2 RING-HC_RBR_TRIAD1_like 128..178 CDD:319537 13/51 (25%)
RING-HC finger (C3HC4-type) 128..178 CDD:319537 13/51 (25%)
IBR 197..259 CDD:214763 18/105 (17%)
IBR <281..320 CDD:366672 18/39 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1815
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469819at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.