DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33144 and ARI5

DIOPT Version :9

Sequence 1:NP_001188904.1 Gene:CG33144 / 36131 FlyBaseID:FBgn0053144 Length:1102 Species:Drosophila melanogaster
Sequence 2:NP_001184920.1 Gene:ARI5 / 837099 AraportID:AT1G05890 Length:594 Species:Arabidopsis thaliana


Alignment Length:296 Identity:76/296 - (25%)
Similarity:114/296 - (38%) Gaps:55/296 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   725 VSSLLSMASANQAAQACCVRDGIALKRREMLASAD-VTPSVGT---PATPTTAFKPFTCKLCLID 785
            ||::||:.....:.........::....|..|..: |..:||.   |...|...:.|||.:| .|
plant   116 VSAVLSITDVEASTLLLHYHWSVSKVNDEWFADEERVRRTVGILEGPVVTTPDGREFTCGIC-FD 179

  Fly   786 VEDVGEAMALQQCGCQFCIECMRAYVEFEISE--GAYEISCPDATCPAQGAISLPEIANLTTTNL 848
            ...:.|.::: .||..||..|...|:...|::  |...:.|||.:|||  ||....|..|.:...
plant   180 SYTLEEIVSV-SCGHPFCATCWTGYISTTINDGPGCLMLKCPDPSCPA--AIGRDMIDKLASKED 241

  Fly   849 LKKHHRYRLNREIELDKTRTWCPRAGCETICTVGAAAQPGQSSVICQMDESPSTSQSYSPQQEVA 913
            .:|::||.|...:|:::...|||..|||.........:                           
plant   242 KEKYYRYFLRSYVEVNREMKWCPAPGCEHAIDFAGGTE--------------------------- 279

  Fly   914 GNGSTGAAAGNGAPVLSVSVHCPSCKDEFCGLCKKAYHPNISCDEFGRRLIADGQDDIGIPFDNE 978
                            |..|.| .|...||..|.:..|..:.||..|:.::.:..:...:.:...
plant   280 ----------------SYDVSC-LCSHSFCWNCTEEAHRPVDCDTVGKWILKNSAESENMNWILA 327

  Fly   979 LIKCCPMCAVPIEKDEGCAQMMC-KRCKHVFCWYCL 1013
            ..|.||.|..||||:.||..|.| ..||..|||.||
plant   328 NSKPCPKCKRPIEKNHGCMHMTCTPPCKFEFCWLCL 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33144NP_001188904.1 IBR 850..956 CDD:214763 19/105 (18%)
IBR <976..1014 CDD:279784 19/39 (49%)
ARI5NP_001184920.1 IBR 243..305 CDD:214763 19/105 (18%)
IBR <327..366 CDD:279784 19/37 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1815
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469819at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11685
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.