DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33144 and ARI12

DIOPT Version :9

Sequence 1:NP_001188904.1 Gene:CG33144 / 36131 FlyBaseID:FBgn0053144 Length:1102 Species:Drosophila melanogaster
Sequence 2:NP_001184919.1 Gene:ARI12 / 837098 AraportID:AT1G05880 Length:496 Species:Arabidopsis thaliana


Alignment Length:307 Identity:69/307 - (22%)
Similarity:112/307 - (36%) Gaps:84/307 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   724 TVSSLLSMASANQAAQACCVRDGIALKRREMLASA-DVTPSVG-TPATPTTAFKPFTCKLCLIDV 786
            :||...|::.|........:|..:....::..|.| .|..||| ....|.:....:.|..|    
plant    57 SVSDFTSLSKAEATLLLSHLRWNVDCICKQWSAGAQSVRDSVGLLELDPPSDDNEYFCGAC---- 117

  Fly   787 EDVGEA-----MALQQCGCQFCIECMRAYVEFEISE-GAYE----ISCP-----DATCPAQGAIS 836
               ||:     :|...||.:.|..|..:::...||| .|.|    :.||     .|:|||  ::.
plant   118 ---GESHPHKNLASVSCGHRICTRCWTSHINKIISEKPAAEWNLWLKCPVRVGLHASCPA--SVG 177

  Fly   837 LPEIANLTTTNLLKKHHRYRLNREIELDKTRTWCPRAGCETICTVGAAAQPGQSSVICQMDESPS 901
            |..|....:......:::|.|...::..:|..|.|..|..                 |.:|.|| 
plant   178 LDTIERFASKREKFNYNQYLLRSYVDNRETMKWHPIQGSR-----------------CAIDLSP- 224

  Fly   902 TSQSYSPQQEVAGNGSTGAAAGNGAPVLSVSVHCPSCKDEFCGLCKKAYHPNISCDEFGRRLIAD 966
                        |:|:.           |||.|   ....||..|::..|..:.|....:.|:.:
plant   225 ------------GSGNA-----------SVSCH---RLVRFCWNCREDAHSPVDCKTAAKWLLEN 263

  Fly   967 GQDDIGIPFDNELIKCCPMCAVPIEKD-EGCAQMMCKRCKHVFCWYC 1012
                 .:|        ||.|.:.|.:: :...:|.|..|.:||||:|
plant   264 -----AVP--------CPKCKLRIPRNQDNSLKMKCLPCNYVFCWFC 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33144NP_001188904.1 IBR 850..956 CDD:214763 20/105 (19%)
IBR <976..1014 CDD:279784 12/38 (32%)
ARI12NP_001184919.1 Zn_Tnp_IS91 <111..>139 CDD:291017 8/34 (24%)
IBR 193..253 CDD:214763 20/103 (19%)
IBR <266..301 CDD:303000 13/40 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1815
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469819at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11685
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.