DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33144 and ARI15

DIOPT Version :9

Sequence 1:NP_001188904.1 Gene:CG33144 / 36131 FlyBaseID:FBgn0053144 Length:1102 Species:Drosophila melanogaster
Sequence 2:NP_001332429.1 Gene:ARI15 / 836496 AraportID:AT5G63760 Length:452 Species:Arabidopsis thaliana


Alignment Length:356 Identity:72/356 - (20%)
Similarity:118/356 - (33%) Gaps:125/356 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   779 CKLC-------------LIDVEDVGEAMALQQCGCQFCIECMRAYVE---FEISEGAYEISCPDA 827
            |.:|             ::|    |:.::...|..:||..|...|::   |.:.:....|||||.
plant    26 CGICSNIGDDDYDGDAVVVD----GDLISTPFCSHKFCKACWSKYLKKNFFSVEKNHTAISCPDR 86

  Fly   828 TCPAQGAISLPEIANLTTTN-------LLKKHHRYRLNREIELDKTRTWCPRAGCETICTVGAAA 885
            .|.|  |:....:..||..:       :||.:....|..:::|      ||..||..:.....|:
plant    87 DCRA--AVGPETVEKLTVRDQAMYELYILKSYREKYLGWKLKL------CPARGCNYVIEFHLAS 143

  Fly   886 QPGQSS--VICQMDESPSTSQSYSPQQEVAGNGSTGAAAGNGAPVLSVSVHCPSCKDEFCGLCKK 948
            :..:.|  ::|                                          .|...||..|..
plant   144 EDEEHSLNIVC------------------------------------------LCGHIFCWRCML 166

  Fly   949 AYHPNISCDEFG-------RRLIADGQDDIGIPFDNELIKCCPMCAVPIEKD--EGCAQMMCKRC 1004
            ..|..::|:...       .:||.:......:.:.:...|.||.|.:|:|.|  ...||.:...|
plant   167 ESHRPVTCNNASDWLSRDLEKLIEEVDKPSTVSWIDANTKPCPHCFIPVEIDGERPWAQFLTCVC 231

  Fly  1005 KHVFCWYCLASLDDDFLLRHYDKGPCKNKLGHSRASVV----WHRAQVIGIFAGFGILLLVASPL 1065
            ...|||.|..|.:     .|...|.|   |..:|:|.|    |:||:                  
plant   232 SGRFCWKCFRSPE-----THGTSGSC---LAPARSSNVGFNHWNRAK------------------ 270

  Fly  1066 LLLAAPCIICCKCRGCTGSKIDEVDAELEEE 1096
                 |.|.|...  ...|:::.|:|:.|.|
plant   271 -----PGISCLDL--WNASQVNLVNAKYELE 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33144NP_001188904.1 IBR 850..956 CDD:214763 15/107 (14%)
IBR <976..1014 CDD:279784 14/39 (36%)
ARI15NP_001332429.1 RING_Ubox <54..88 CDD:388418 11/33 (33%)
IBR 106..174 CDD:214763 16/115 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1815
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469819at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11685
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.