DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33144 and AT5G63740

DIOPT Version :10

Sequence 1:NP_788324.1 Gene:CG33144 / 36131 FlyBaseID:FBgn0053144 Length:1102 Species:Drosophila melanogaster
Sequence 2:NP_201179.1 Gene:AT5G63740 / 836494 AraportID:AT5G63740 Length:226 Species:Arabidopsis thaliana


Alignment Length:62 Identity:20/62 - (32%)
Similarity:28/62 - (45%) Gaps:5/62 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   785 DVEDVGEAMALQQCGCQFCIECMRAYVE---FEISEGAYEISCPDATCPAQGAISLPEIANL 843
            |..|....::...|..:||..|.|.|:|   :.:.|....|||||..|.|  ::.|..|..|
plant   137 DEYDSHRLISTPYCTHKFCKTCWREYLETNFYSLEENLTVISCPDQDCGA--SVRLKTIEKL 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33144NP_788324.1 mRING-HC-C4C4_RBR_RNF144 777..829 CDD:438294 15/46 (33%)
BRcat_RBR_RNF144 860..961 CDD:439010
Rcat_RBR_RNF144 976..1045 CDD:439013
AT5G63740NP_201179.1 RING_Ubox 139..188 CDD:473075 16/50 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.