DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33144 and ARI16

DIOPT Version :9

Sequence 1:NP_001188904.1 Gene:CG33144 / 36131 FlyBaseID:FBgn0053144 Length:1102 Species:Drosophila melanogaster
Sequence 2:NP_680158.1 Gene:ARI16 / 830774 AraportID:AT5G08730 Length:500 Species:Arabidopsis thaliana


Alignment Length:225 Identity:50/225 - (22%)
Similarity:78/225 - (34%) Gaps:57/225 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   798 CGCQFCIECMRAYVEFEISEGAYE---ISCPDATCPAQGAISLPEIANLTTTNLLKKHHRYRLNR 859
            |..:|...|...|:...:.:...:   |||....|.|...   |:.....|..:.:.:..|.|..
plant    96 CSHKFSTTCWSEYLSDALKKNKEQRGLISCLSQDCVASVG---PDTIEQLTEPVKEMYENYILES 157

  Fly   860 EIELDK-TRTWCPRAGCETICTVGAAAQPGQSSVICQMDESPSTSQSYSPQQEVAGNGSTGAAAG 923
            .:|..| |..|||.:|||                             |:.:.:..||...     
plant   158 FMECHKATIKWCPASGCE-----------------------------YAVELQEDGNEDN----- 188

  Fly   924 NGAPVLSVSVHCPSCKDEFCGLCKKAYHPNISCDE---FGRRLIADGQDDIGIPFDNELIKCCPM 985
                  .:||.| .|...||..|....|..:||.:   :...|:...:   .|.:.:...|.||.
plant   189 ------VISVVC-LCGHTFCWTCGLESHRPVSCKKASIWWTYLLDQSR---SISWIHTNTKSCPK 243

  Fly   986 CAVPIEK--DEGCAQMMCKRCKHVFCWYCL 1013
            |.:|:::  |.....:.| .|.:.|||.||
plant   244 CKIPVQQNGDPNYRLINC-ICSNNFCWICL 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33144NP_001188904.1 IBR 850..956 CDD:214763 22/106 (21%)
IBR <976..1014 CDD:279784 13/40 (33%)
ARI16NP_680158.1 IBR 148..214 CDD:214763 22/106 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1815
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469819at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11685
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.