DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33144 and ARI1

DIOPT Version :9

Sequence 1:NP_001188904.1 Gene:CG33144 / 36131 FlyBaseID:FBgn0053144 Length:1102 Species:Drosophila melanogaster
Sequence 2:NP_567966.1 Gene:ARI1 / 829587 AraportID:AT4G34370 Length:597 Species:Arabidopsis thaliana


Alignment Length:303 Identity:71/303 - (23%)
Similarity:101/303 - (33%) Gaps:90/303 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   754 MLASADVTP---SVGTPATPTTAFKPFTCKLCLIDVEDVGEAMALQQCGCQFCIECMRAYVEFEI 815
            :.:.|.||.   ..|..:.|.::  ..:|.:|:.|:.  |:.|....||..||..|...:...:|
plant    97 LFSGAGVTVFDYQYGNSSFPQSS--QMSCDVCMEDLP--GDHMTRMDCGHCFCNNCWTEHFTVQI 157

  Fly   816 SEG-AYEISCPDATCPAQGAISLPEIANLTTT----NLLKKHHRYRLNREIELDKTRTWCP---- 871
            :|| :..|.|....|   .||...:|.....:    :|..|..||.|...||.::...|||    
plant   158 NEGQSKRIRCMAHQC---NAICDEDIVRSLVSKKRPDLAAKFDRYLLESYIEDNRMVKWCPSTPH 219

  Fly   872 -----RAGCETICTVGAAAQPGQSSVICQMDESPSTSQSYSPQQEVAGNGSTGAAAGNGAPVLSV 931
                 ||..:.:|                                                    
plant   220 CGNAIRAEDDKLC---------------------------------------------------- 232

  Fly   932 SVHCPSCKDEFCGLCKKAYHPNISC--DEFGRRLIADGQDDIGIPFDNELIKCCPMCAVPIEKDE 994
            .|.| ||..:||..|....|...||  .|..|:...|..:.|.  :.....|.||.|..|:||:.
plant   233 EVEC-SCGLQFCFSCLCQAHSPCSCLMWELWRKKCRDESETIN--WITVHTKLCPKCYKPVEKNG 294

  Fly   995 GCAQMMCKRCKHVFCWYCLASLDDDFLLRHYDKGPCKNKLGHS 1037
            ||..:.| .|...|||.|..:...|...|        :..|||
plant   295 GCNLVRC-ICGQCFCWLCGGATGSDHTYR--------SIAGHS 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33144NP_001188904.1 IBR 850..956 CDD:214763 20/114 (18%)
IBR <976..1014 CDD:279784 15/37 (41%)
ARI1NP_567966.1 IBR 194..256 CDD:214763 20/114 (18%)
IBR <284..313 CDD:279784 13/29 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1815
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469819at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.