DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33144 and AT3G45580

DIOPT Version :10

Sequence 1:NP_788324.1 Gene:CG33144 / 36131 FlyBaseID:FBgn0053144 Length:1102 Species:Drosophila melanogaster
Sequence 2:NP_190144.1 Gene:AT3G45580 / 823700 AraportID:AT3G45580 Length:408 Species:Arabidopsis thaliana


Alignment Length:237 Identity:59/237 - (24%)
Similarity:96/237 - (40%) Gaps:45/237 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   778 TCKLCLIDVEDVGEAMALQQCGCQFCIECMRAYVEFEISEGAYEISCPDATCPAQGAISLPEIAN 842
            ||.:|..|..:.....::..||.:||:||::.::|..:..|... .|....|  :..::|...||
plant   172 TCSICSDDNFEPELMFSVALCGHEFCVECVKRHIEVRLLAGGVP-RCLHYQC--ESKLTLANCAN 233

  Fly   843 LTTTNLLKKHHRYRLNREIELDKTRTWCPRAGCETICTVGAAAQPGQSSVICQMDESPSTSQSYS 907
            |.|:. ||.....|:..|....:.|.:||...|.::.:|                    |..|.|
plant   234 LLTSK-LKAMWELRIEEESIPVEERVYCPNPRCSSLMSV--------------------TKLSNS 277

  Fly   908 PQQEVAGNGSTGAAAGNGAPVLSVSVHCPSCKDEFCGLCKKAYHPNISCDEFGRRLIADGQDDIG 972
            .:::|....                  |..|.:.||..||..:|.|:||:::.........|||.
plant   278 TREDVTMRS------------------CVKCGEPFCINCKLPWHSNLSCNDYKSLGPNPTADDIK 324

  Fly   973 IP--FDNELIKCCPMCAVPIEKDEGCAQMMCKRCKHVFCWYC 1012
            :.  .:.::.:.|..|...||..|||..:.| ||.|.||:.|
plant   325 LKALANQKMWRQCENCKNVIELSEGCMHITC-RCGHQFCYKC 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33144NP_788324.1 mRING-HC-C4C4_RBR_RNF144 777..829 CDD:438294 13/50 (26%)
BRcat_RBR_RNF144 860..961 CDD:439010 20/100 (20%)
Rcat_RBR_RNF144 976..1045 CDD:439013 14/37 (38%)
AT3G45580NP_190144.1 RNase_H_like 44..154 CDD:449355
RING_Ubox 172..223 CDD:473075 14/53 (26%)
BRcat_RBR_unk 256..311 CDD:439033 19/92 (21%)
Rcat_RBR_unk 333..369 CDD:439035 14/34 (41%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.