DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33144 and AT3G45560

DIOPT Version :10

Sequence 1:NP_788324.1 Gene:CG33144 / 36131 FlyBaseID:FBgn0053144 Length:1102 Species:Drosophila melanogaster
Sequence 2:NP_190142.1 Gene:AT3G45560 / 823698 AraportID:AT3G45560 Length:503 Species:Arabidopsis thaliana


Alignment Length:209 Identity:50/209 - (23%)
Similarity:85/209 - (40%) Gaps:35/209 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   726 SSLLSMASANQAAQACCVRDGIALKRREMLASADVTPSVGTPATPTTAFKPFTCKLCLIDVEDVG 790
            ||:..:.:.|||..|.    .:|::......|.|:.||           :..||.:|..|.....
plant   117 SSIPVLMTRNQAKFAY----KLAMETIVSEISIDMAPS-----------QRKTCGICFNDDFKAE 166

  Fly   791 EAMALQQCGCQFCIECMRAYVEFEISEGAYEISCPDATCPAQGAISLPEIANLTTTNLLKK-HHR 854
            ...::..||.|||:|||..|::..:.|.: |:.||...|  :..:::...|||.|..|.:. .||
plant   167 HMFSVDLCGHQFCVECMTQYIKVRLLEES-EMRCPHYQC--ESKLTVVRCANLLTPELREMWEHR 228

  Fly   855 YRLNREIELDKTRTWCP------------RAGCETICTVGAAAQPGQSSVICQMDESPSTSQSYS 907
            .:....:..||  .:|.            |.|...:.::.|:|...:....|:...:.....|::
plant   229 SQKESVVVADK--AYCQIECAWLLCQMEFRDGALDVVSLIASAAKFRGITTCRASNTRDADISFA 291

  Fly   908 PQQEVAGNGSTGAA 921
            ...|:  |||...|
plant   292 THVEM--NGSKEVA 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33144NP_788324.1 mRING-HC-C4C4_RBR_RNF144 777..829 CDD:438294 17/51 (33%)
BRcat_RBR_RNF144 860..961 CDD:439010 14/74 (19%)
Rcat_RBR_RNF144 976..1045 CDD:439013
AT3G45560NP_190142.1 RNase_H_like 26..135 CDD:449355 6/21 (29%)
RING-HC_RBR_RNF14 154..205 CDD:438290 18/53 (34%)
RNase_H_like 323..>417 CDD:449355
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.