DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33144 and AT3G45555

DIOPT Version :10

Sequence 1:NP_788324.1 Gene:CG33144 / 36131 FlyBaseID:FBgn0053144 Length:1102 Species:Drosophila melanogaster
Sequence 2:NP_680100.1 Gene:AT3G45555 / 823697 AraportID:AT3G45555 Length:213 Species:Arabidopsis thaliana


Alignment Length:255 Identity:61/255 - (23%)
Similarity:99/255 - (38%) Gaps:71/255 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   776 PFTCKLCLIDVEDVGEAMALQQCGCQFCIECMRAYVEFEISEGAYEISCPDATCPAQGAISLPEI 840
            |.||.:|..|.....:...:..|..:||:|||:.|:|..:.||...| ||...|  :..::|...
plant    14 PETCSICFNDDFKSEQMYYVALCNHKFCLECMKRYIEVRLLEGTVLI-CPYYQC--ESKLTLKSC 75

  Fly   841 ANLTTTNLLKKHHRYRLNREIELDKTRTWCPRAGCETICTVGAAAQPGQSSVICQMDESPSTSQS 905
            .::.|:. ||.....::..|......|.:||...|              |:::.:::.|.||.: 
plant    76 FHILTSK-LKAMWEQKIEEESIPVTERFYCPNPRC--------------SALMSKIELSKSTLE- 124

  Fly   906 YSPQQEVAGNGSTGAAAGNGAPVLSVSVHCPSCKDEFCGLCKKAYHPNISCDEFGRRLIADGQDD 970
                              :|      .|.|..|.:.||..||.::..|:|||.. ::|   |.:.
plant   125 ------------------DG------FVRCFQCGERFCINCKVSWQSNLSCDNC-KKL---GNNP 161

  Fly   971 IGIPFDNELIKC---------CPMCAVPIEKDEGCAQMMCKRCKHVFCWYCLASLDDDFL 1021
            ..   |::::|.         |..|...|:..|||.        ||.|.|    |.:.||
plant   162 TS---DDKMLKVLANEKKWRQCEKCQHMIKLSEGCI--------HVTCMY----LSNHFL 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33144NP_788324.1 mRING-HC-C4C4_RBR_RNF144 777..829 CDD:438294 17/51 (33%)
BRcat_RBR_RNF144 860..961 CDD:439010 21/100 (21%)
Rcat_RBR_RNF144 976..1045 CDD:439013 15/55 (27%)
AT3G45555NP_680100.1 RING-HC_RBR_RNF14 10..67 CDD:438290 19/55 (35%)
BRcat_RBR_unk 98..152 CDD:439033 18/92 (20%)
BRcat_Rcat_RBR 176..>198 CDD:459240 8/29 (28%)

Return to query results.
Submit another query.