DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33144 and AT3G45510

DIOPT Version :10

Sequence 1:NP_788324.1 Gene:CG33144 / 36131 FlyBaseID:FBgn0053144 Length:1102 Species:Drosophila melanogaster
Sequence 2:NP_190137.1 Gene:AT3G45510 / 823691 AraportID:AT3G45510 Length:257 Species:Arabidopsis thaliana


Alignment Length:208 Identity:49/208 - (23%)
Similarity:77/208 - (37%) Gaps:50/208 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   752 REMLASADVTPSVGTPATPTTAFKPFTCKLCLIDVEDVGEAMALQQCGCQFCIECMRAYVEFEIS 816
            :|.|.|.::.|      .|.|..|. ||.:|.:|..:..|..:...|...||:|||:..:|..::
plant    46 KETLVSRNIRP------MPRTTQKK-TCGICFVDDIEGQEMFSAALCSHYFCVECMKQRIEVSLN 103

  Fly   817 EGAYEISCPDATCPAQGAISLPEIANLTTTNLLKKHHRYRLNREIELDKTRTWCPRAGCETICTV 881
            ||... .||...|  :.|::|....:|.|.. .::....|:..|......|..||...|..:   
plant   104 EGGVP-RCPRHGC--KSALTLRSCDHLLTPK-QREMWEQRIKEESIPVCNRFHCPNPKCWAL--- 161

  Fly   882 GAAAQPGQSSVICQMDESPSTSQSYSPQQEVAGNGSTGAAAGNGAPVLSVSVHCPSCKDEFCGLC 946
                          |.::..|        |...:|              |...|..|:..||..|
plant   162 --------------MSKTELT--------ESTDDG--------------VRRCCSKCRKPFCIDC 190

  Fly   947 KKAYHPNISCDEF 959
            ..::|.|:||.|:
plant   191 NVSWHSNLSCKEY 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33144NP_788324.1 mRING-HC-C4C4_RBR_RNF144 777..829 CDD:438294 16/51 (31%)
BRcat_RBR_RNF144 860..961 CDD:439010 20/100 (20%)
Rcat_RBR_RNF144 976..1045 CDD:439013
AT3G45510NP_190137.1 RING_Ubox 65..116 CDD:473075 17/53 (32%)
BRcat_RBR_unk 147..203 CDD:439033 18/94 (19%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.