DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33144 and AT3G45500

DIOPT Version :10

Sequence 1:NP_788324.1 Gene:CG33144 / 36131 FlyBaseID:FBgn0053144 Length:1102 Species:Drosophila melanogaster
Sequence 2:NP_190136.1 Gene:AT3G45500 / 823690 AraportID:AT3G45500 Length:201 Species:Arabidopsis thaliana


Alignment Length:45 Identity:11/45 - (24%)
Similarity:24/45 - (53%) Gaps:8/45 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   490 SLSISGSSSSLNVVQQK------IWHIMRREGSASSLHQEKSQSI 528
            |:|:...|||||.:::.      :|:::....|.:..  .||:::
plant   104 SISVDPPSSSLNGIEKLKLEDVIVWNVVNPYASTAKF--GKSENV 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33144NP_788324.1 mRING-HC-C4C4_RBR_RNF144 777..829 CDD:438294
BRcat_RBR_RNF144 860..961 CDD:439010
Rcat_RBR_RNF144 976..1045 CDD:439013
AT3G45500NP_190136.1 RNase_H_like 23..>87 CDD:449355
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.