DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33144 and AT3G43750

DIOPT Version :10

Sequence 1:NP_788324.1 Gene:CG33144 / 36131 FlyBaseID:FBgn0053144 Length:1102 Species:Drosophila melanogaster
Sequence 2:NP_189961.1 Gene:AT3G43750 / 823486 AraportID:AT3G43750 Length:346 Species:Arabidopsis thaliana


Alignment Length:229 Identity:58/229 - (25%)
Similarity:97/229 - (42%) Gaps:43/229 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   776 PFTCKLCLIDVEDVGEAMALQQCGCQFCIECMRAYVEFEISEGAYEISCPDATCPAQGAISLPEI 840
            |.||.:|..:|.:..:..::..||.|||:||::.|:|.::.||... .|.|..|  :..::|...
plant   152 PATCSICFNNVLEAEKMFSVAICGHQFCVECVKHYIEVKLLEGGVP-RCLDYQC--ESKLTLTSC 213

  Fly   841 ANLTTTNLLKKHHRYRLNREIELDKTRTWCPRAGCETICTVGAAAQPGQSSVICQMDESPSTSQS 905
            .||.|.. ||...:.|:..|:.|...|.:||...|              |.::.:.:.|.||.:.
plant   214 GNLLTPK-LKAIWKQRIEEELILVAERVYCPNPRC--------------SGLMSKTELSTSTEED 263

  Fly   906 YSPQQEVAGNGSTGAAAGNGAPVLSVSVHCPSCKDEFCGLCKKAYHPNISCDEFGRRLIADGQDD 970
                                   :|....|..|.:.||..||..:|.|:|||::.|......::|
plant   264 -----------------------VSTRTCCVKCGEPFCINCKVPWHSNLSCDDYKRLGPNPTKND 305

  Fly   971 IGIPF--DNELIKCCPMCAVPIEKDEGCAQMMCK 1002
            |.:..  :.:....|..|...|.:.|||..::|:
plant   306 IKLKVLANQQKWSQCAKCQHMIARIEGCNVIICR 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33144NP_788324.1 mRING-HC-C4C4_RBR_RNF144 777..829 CDD:438294 17/51 (33%)
BRcat_RBR_RNF144 860..961 CDD:439010 22/100 (22%)
Rcat_RBR_RNF144 976..1045 CDD:439013 7/27 (26%)
AT3G43750NP_189961.1 RNase_H_like 26..139 CDD:449355
RING_Ubox 154..205 CDD:473075 18/53 (34%)
BRcat_RBR_unk 236..294 CDD:439033 20/94 (21%)
BRcat_Rcat_RBR 316..>339 CDD:459240 6/22 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.