DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33144 and AT3G43180

DIOPT Version :10

Sequence 1:NP_788324.1 Gene:CG33144 / 36131 FlyBaseID:FBgn0053144 Length:1102 Species:Drosophila melanogaster
Sequence 2:NP_189904.1 Gene:AT3G43180 / 823392 AraportID:AT3G43180 Length:191 Species:Arabidopsis thaliana


Alignment Length:120 Identity:27/120 - (22%)
Similarity:48/120 - (40%) Gaps:14/120 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   776 PFTCKLCLIDVEDVGEAMALQQCGCQFCIECMRAYVEFEISEGAYEISCPDATCPAQGAISLPEI 840
            |..|::|..:.....:..::..||.|||::|::.::|..:.||... .||...|  :..::....
plant    56 PAICRICFDEDVKAEQMYSVALCGHQFCVDCVKQHIESRLLEGCVP-RCPHDQC--EYKLTFRSC 117

  Fly   841 ANLTTTNLLKKHHRYRLNREIELD-----------KTRTWCPRAGCETICTVGAA 884
            |||.|.........|.|.:.::|.           .|..:.....|..:.|.|.|
plant   118 ANLLTPKTKSDSSIYLLLKTLKLGDVVSNAVNPFASTAKFHGIVTCHAVITRGVA 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33144NP_788324.1 mRING-HC-C4C4_RBR_RNF144 777..829 CDD:438294 13/51 (25%)
BRcat_RBR_RNF144 860..961 CDD:439010 6/36 (17%)
Rcat_RBR_RNF144 976..1045 CDD:439013
AT3G43180NP_189904.1 RING_Ubox 59..108 CDD:473075 13/49 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.