DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33144 and ARI4

DIOPT Version :9

Sequence 1:NP_001188904.1 Gene:CG33144 / 36131 FlyBaseID:FBgn0053144 Length:1102 Species:Drosophila melanogaster
Sequence 2:NP_189409.1 Gene:ARI4 / 822394 AraportID:AT3G27720 Length:493 Species:Arabidopsis thaliana


Alignment Length:204 Identity:46/204 - (22%)
Similarity:68/204 - (33%) Gaps:63/204 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   843 LTTTNLLKKHHRYRLNREIELDKTRTWCPRAGCETICTVGAAAQPGQSSVICQMDESPSTSQSYS 907
            |.:|.|.:|..|:.:...:|.:....||                             |||....:
plant   143 LVSTELAEKFDRFLIESYVEDNNMVKWC-----------------------------PSTPHCGN 178

  Fly   908 PQQEVAGNGSTGAAAGNGAPVLSVSVHCPSCKDEFCGLCKKAYHPNISC--DEFGRRLIADGQDD 970
            ..:.:..:|...            .|.| ||..:||..|....|...||  .:..::...|..:.
plant   179 AIRNIKDDGDVD------------EVEC-SCGLQFCFSCLSESHSPCSCLMWKLWKKKCEDESET 230

  Fly   971 IGIPFDNELIKCCPMCAVPIEKDEGCAQMMCKRCKHVFCWYCLASLDDDFLLRHYDKGPCKNKLG 1035
            :.....|  .|.||.|:.||:|.:||..|.|| |...|||.|..:...|                
plant   231 VNWMTVN--TKLCPKCSKPIQKRDGCNHMTCK-CGQHFCWLCGQATGRD---------------- 276

  Fly  1036 HSRASVVWH 1044
            ||.:|:..|
plant   277 HSYSSIAGH 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33144NP_001188904.1 IBR 850..956 CDD:214763 17/105 (16%)
IBR <976..1014 CDD:279784 18/37 (49%)
ARI4NP_189409.1 IBR 150..214 CDD:214763 17/105 (16%)
IBR <237..271 CDD:366672 18/36 (50%)
COG4026 <391..479 CDD:226513
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1815
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469819at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.