DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33144 and ARI3

DIOPT Version :9

Sequence 1:NP_001188904.1 Gene:CG33144 / 36131 FlyBaseID:FBgn0053144 Length:1102 Species:Drosophila melanogaster
Sequence 2:NP_189408.1 Gene:ARI3 / 822393 AraportID:AT3G27710 Length:537 Species:Arabidopsis thaliana


Alignment Length:298 Identity:68/298 - (22%)
Similarity:108/298 - (36%) Gaps:78/298 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   754 MLASADVT---PSVGTPATPTTAFKPFTCKLCLIDVEDV-GEAMALQQCGCQFCIECMRAYVEFE 814
            |.:.|.:|   ||:      .|:.|...|.:|:.|  |: ...|...:||.:||.:|...:...:
plant    99 MFSCAGLTVFVPSL------VTSKKTMKCDVCMED--DLPSNVMTRMECGHRFCNDCWIGHFTVK 155

  Fly   815 ISEG-AYEISCPDATCPAQGAISLPEIANLTTTNLLKKHHRYRLNREIELDKTRTWCPRAGCETI 878
            |:|| :..|.|....|.|  ......:..|.:..|..::.|:.:...:|.:....|||       
plant   156 INEGESKRILCMAHECKA--ICDEDVVRKLVSPELADRYDRFLIESYVEDNNMVKWCP------- 211

  Fly   879 CTVGAAAQPGQSSVICQMDESPSTSQSYSPQQEVAGNGSTGAAAGNGAPVLSVSVHCPSCKDEFC 943
                  ::|...|.|.::::....                            |.|.| ||..:||
plant   212 ------SKPHCGSAIRKIEDGHDV----------------------------VEVGC-SCGLQFC 241

  Fly   944 GLCKKAYHPNISC--DEFGRRLIADGQDDIGIPFDNELIKCCPMCAVPIEKDEGCAQMMCKRCKH 1006
            ..|....|...||  .:..::...|..:.:.....|  .|.||.|:.||:|.:||..|.|| |..
plant   242 FSCLSESHSPCSCLMWKLWKKKCEDESETVNWITVN--TKLCPKCSKPIQKRDGCNLMTCK-CGQ 303

  Fly  1007 VFCWYCLASLDDDFLLRHYDKGPCKNKLGHSRASVVWH 1044
            .|||.|..:...|                |:..|:..|
plant   304 HFCWLCGQATGRD----------------HTYTSIAGH 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33144NP_001188904.1 IBR 850..956 CDD:214763 17/105 (16%)
IBR <976..1014 CDD:279784 18/37 (49%)
ARI3NP_189408.1 RING-HC_RBR_TRIAD1_like 121..171 CDD:319537 15/51 (29%)
RING-HC finger (C3HC4-type) 121..171 CDD:319537 15/51 (29%)
IBR 190..254 CDD:214763 17/105 (16%)
IBR <277..311 CDD:366672 18/36 (50%)
COG4026 <431..519 CDD:226513
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1815
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469819at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.