DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33144 and ARI7

DIOPT Version :10

Sequence 1:NP_788324.1 Gene:CG33144 / 36131 FlyBaseID:FBgn0053144 Length:1102 Species:Drosophila melanogaster
Sequence 2:NP_180709.3 Gene:ARI7 / 817709 AraportID:AT2G31510 Length:562 Species:Arabidopsis thaliana


Alignment Length:265 Identity:67/265 - (25%)
Similarity:102/265 - (38%) Gaps:54/265 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   760 VTPSVG---TPATPTTAFKPFTCKLCLIDVEDVGEAMALQQCGCQFCIECMRAYVEFEISE--GA 819
            |..:||   :...|.:.....||.:|......  |.:|...||..||..|...|:...|::  |.
plant   115 VRKTVGILESHVVPPSDDSELTCGICFDSYPP--EKIASVSCGHPFCTTCWTGYISTTINDGPGC 177

  Fly   820 YEISCPDATCPAQGAISLPEIANLTTTNLLKKHHRYRLNREIELDKTRTWCPRAGCETICTVGAA 884
            ..:.|||.:|.|  |:....:..|.:.:..:|::||.|...||.::...|||..||:.....   
plant   178 LMLRCPDPSCLA--AVGHDMVDKLASEDEKEKYNRYFLRSYIEDNRKMKWCPAPGCDFAIDF--- 237

  Fly   885 AQPGQSSVICQMDESPSTSQSYSPQQEVAGNGSTGAAAGNGAPVLSVSVHCPSCKDEFCGLCKKA 949
                                       |||:|             :..|.| .|...||..|.:.
plant   238 ---------------------------VAGSG-------------NYDVSC-LCSFSFCWNCTEE 261

  Fly   950 YHPNISCDEFGRRLIADGQDDIGIPFDNELIKCCPMCAVPIEKDEGCAQMMC-KRCKHVFCWYCL 1013
            .|..:.|....:.::.:..:...:.:.....|.||.|..||||::||..|.| ..||:.|||.||
plant   262 AHRPVDCSTVSKWILKNSAESENMNWILANSKPCPRCKRPIEKNQGCMHMTCTPPCKYEFCWLCL 326

  Fly  1014 ASLDD 1018
            .:..|
plant   327 GAWMD 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33144NP_788324.1 mRING-HC-C4C4_RBR_RNF144 777..829 CDD:438294 16/53 (30%)
BRcat_RBR_RNF144 860..961 CDD:439010 19/100 (19%)
Rcat_RBR_RNF144 976..1045 CDD:439013 20/44 (45%)
ARI7NP_180709.3 RING-HC_ARI6-like 134..195 CDD:438503 19/64 (30%)
BRcat_RBR_ANKIB1 213..277 CDD:439007 20/107 (19%)
Rcat_RBR_ARI7-like 291..345 CDD:439034 20/41 (49%)
Ariadne 355..>516 CDD:466073
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.