DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33144 and ARI7

DIOPT Version :9

Sequence 1:NP_001188904.1 Gene:CG33144 / 36131 FlyBaseID:FBgn0053144 Length:1102 Species:Drosophila melanogaster
Sequence 2:NP_180709.3 Gene:ARI7 / 817709 AraportID:AT2G31510 Length:562 Species:Arabidopsis thaliana


Alignment Length:265 Identity:67/265 - (25%)
Similarity:102/265 - (38%) Gaps:54/265 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   760 VTPSVG---TPATPTTAFKPFTCKLCLIDVEDVGEAMALQQCGCQFCIECMRAYVEFEISE--GA 819
            |..:||   :...|.:.....||.:|......  |.:|...||..||..|...|:...|::  |.
plant   115 VRKTVGILESHVVPPSDDSELTCGICFDSYPP--EKIASVSCGHPFCTTCWTGYISTTINDGPGC 177

  Fly   820 YEISCPDATCPAQGAISLPEIANLTTTNLLKKHHRYRLNREIELDKTRTWCPRAGCETICTVGAA 884
            ..:.|||.:|.|  |:....:..|.:.:..:|::||.|...||.::...|||..||:.....   
plant   178 LMLRCPDPSCLA--AVGHDMVDKLASEDEKEKYNRYFLRSYIEDNRKMKWCPAPGCDFAIDF--- 237

  Fly   885 AQPGQSSVICQMDESPSTSQSYSPQQEVAGNGSTGAAAGNGAPVLSVSVHCPSCKDEFCGLCKKA 949
                                       |||:|             :..|.| .|...||..|.:.
plant   238 ---------------------------VAGSG-------------NYDVSC-LCSFSFCWNCTEE 261

  Fly   950 YHPNISCDEFGRRLIADGQDDIGIPFDNELIKCCPMCAVPIEKDEGCAQMMC-KRCKHVFCWYCL 1013
            .|..:.|....:.::.:..:...:.:.....|.||.|..||||::||..|.| ..||:.|||.||
plant   262 AHRPVDCSTVSKWILKNSAESENMNWILANSKPCPRCKRPIEKNQGCMHMTCTPPCKYEFCWLCL 326

  Fly  1014 ASLDD 1018
            .:..|
plant   327 GAWMD 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33144NP_001188904.1 IBR 850..956 CDD:214763 22/105 (21%)
IBR <976..1014 CDD:279784 18/38 (47%)
ARI7NP_180709.3 RING-HC_RBR_TRIAD1_like 137..187 CDD:319537 15/51 (29%)
IBR 206..268 CDD:214763 22/105 (21%)
IBR <290..329 CDD:396187 19/38 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1815
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469819at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11685
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.