DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33144 and AT2G25370

DIOPT Version :10

Sequence 1:NP_788324.1 Gene:CG33144 / 36131 FlyBaseID:FBgn0053144 Length:1102 Species:Drosophila melanogaster
Sequence 2:NP_180109.2 Gene:AT2G25370 / 817076 AraportID:AT2G25370 Length:603 Species:Arabidopsis thaliana


Alignment Length:275 Identity:55/275 - (20%)
Similarity:111/275 - (40%) Gaps:51/275 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   742 CVRDGIALKRREM-LASADVTPSVGTPATPTTAFKPFTCKLCLIDVEDVGEAMALQQCGCQFCIE 805
            |: |.:.:.|.:: .|......::|..:....|.:..||.: ..:..||......::|..:.|..
plant   267 CI-DAVLVARNDVKFAFRLAREAIGRNSVDVNAEQGETCGI-FFEETDVEHMFVTEKCLHRHCFP 329

  Fly   806 CMRAYVEFEISEGAYEISCPDATCPAQGAISLPEIANLTTTNLLKKHHRYRLNREIELDKTRTWC 870
            |::.:|:.::..|. |.:|.:..|..:  ::|...:.:.|..|::. .:.::..:......|.:|
plant   330 CVKQHVKVKLRSGT-EPTCLEYGCKFK--LTLERCSKVLTLKLIEM-WKQKMKEDSIPAAERIYC 390

  Fly   871 PRAGCETICTVGAAAQPGQSSVICQMDESPSTSQSYSPQQEVAGNGSTGAAAGNGAPVLSVSVHC 935
            |...|..:                 |.::..:|:                     |.:.:|.. |
plant   391 PYPNCSML-----------------MSKTELSSE---------------------ADLSNVRT-C 416

  Fly   936 PSCKDEFCGLCKKAYHPNISCDEFGRRLIADG-QDDIGIP--FDNELIKCCPMCAVPIEKDEGCA 997
            ..|...||..||...|.::|.|:: ::|..|. .||:.:.  .::::.:.|..|...||...||.
plant   417 VKCCGLFCIDCKVPSHTDLSYDDY-KKLHPDPLVDDLKLKSLANDKMWRQCVKCRHMIELSHGCN 480

  Fly   998 QMMCKRCKHVFCWYC 1012
            .|.| ||.:.||:.|
plant   481 HMTC-RCGYEFCYEC 494

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33144NP_788324.1 mRING-HC-C4C4_RBR_RNF144 777..829 CDD:438294 11/51 (22%)
BRcat_RBR_RNF144 860..961 CDD:439010 17/100 (17%)
Rcat_RBR_RNF144 976..1045 CDD:439013 13/37 (35%)
AT2G25370NP_180109.2 RNase_H_like 171..288 CDD:449355 4/21 (19%)
BRcat_RBR_unk 384..440 CDD:439033 17/94 (18%)
Rcat_RBR_unk 462..498 CDD:439035 13/34 (38%)

Return to query results.
Submit another query.