DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33144 and ARI2

DIOPT Version :9

Sequence 1:NP_001188904.1 Gene:CG33144 / 36131 FlyBaseID:FBgn0053144 Length:1102 Species:Drosophila melanogaster
Sequence 2:NP_179206.2 Gene:ARI2 / 816106 AraportID:AT2G16090 Length:593 Species:Arabidopsis thaliana


Alignment Length:244 Identity:61/244 - (25%)
Similarity:87/244 - (35%) Gaps:63/244 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   778 TCKLCLIDVEDV-GEAMALQQCGCQFCIECMRAYVEFEISEG-AYEISCPDATCPAQGAISLPEI 840
            :|.:|   |||| |..:....||..||..|...:...:|:|| :..|.|....|   .||...::
plant   123 SCDIC---VEDVPGYQLTRMDCGHSFCNNCWTGHFTVKINEGQSKRIICMAHKC---NAICDEDV 181

  Fly   841 ANLTTT----NLLKKHHRYRLNREIELDKTRTWCPRA-GCETICTVGAAAQPGQSSVICQMDESP 900
            .....:    :|.:|..|:.|...||.:|...|||.. .|.....|       :...:|:     
plant   182 VRALVSKSQPDLAEKFDRFLLESYIEDNKMVKWCPSTPHCGNAIRV-------EDDELCE----- 234

  Fly   901 STSQSYSPQQEVAGNGSTGAAAGNGAPVLSVSVHCPSCKDEFCGLCKKAYHPNISCD--EFGRRL 963
                                            |.| ||..:||..|....|...||.  |..|:.
plant   235 --------------------------------VEC-SCGLQFCFSCSSQAHSPCSCVMWELWRKK 266

  Fly   964 IADGQDDIGIPFDNELIKCCPMCAVPIEKDEGCAQMMCKRCKHVFCWYC 1012
            ..|..:.:.  :.....|.||.|..|:||:.||..:.| .|:..|||.|
plant   267 CFDESETVN--WITVHTKPCPKCHKPVEKNGGCNLVTC-LCRQSFCWLC 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33144NP_001188904.1 IBR 850..956 CDD:214763 20/106 (19%)
IBR <976..1014 CDD:279784 15/37 (41%)
ARI2NP_179206.2 RING_Ubox 126..174 CDD:418438 17/53 (32%)
IBR 195..257 CDD:214763 20/106 (19%)
IBR <283..314 CDD:396187 14/31 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1815
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469819at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.