DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33144 and si:ch211-278j3.3

DIOPT Version :9

Sequence 1:NP_001188904.1 Gene:CG33144 / 36131 FlyBaseID:FBgn0053144 Length:1102 Species:Drosophila melanogaster
Sequence 2:XP_696570.3 Gene:si:ch211-278j3.3 / 568165 ZFINID:ZDB-GENE-041014-147 Length:611 Species:Danio rerio


Alignment Length:330 Identity:86/330 - (26%)
Similarity:131/330 - (39%) Gaps:74/330 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   779 CKLCLIDVEDVGEAMALQQCGCQFCIECMRAYVEFEISEGAYEISCPDATCPAQGAISLPEI-AN 842
            |.|||:. :.......|..|..:.|.:|:|.|:..||||....|:||.  ||.  |::||:: |.
Zfish   112 CPLCLLS-QPRAHFPRLSSCQHRACTDCLRQYLRIEISESRVGIACPQ--CPE--ALALPDVRAI 171

  Fly   843 LTTTNLLKKHHRYRLNREIELDKTRTWCPRAGCE-TICTVGAAAQPGQSSVICQMDESPSTSQSY 906
            |....||::...::|.|.:..|....|||...|. .:...|.|..|..|   |            
Zfish   172 LDDGALLERFEEFQLRRFLAADPDTRWCPAPDCSYAVIAYGCAECPKLS---C------------ 221

  Fly   907 SPQQEVAGNGSTGAAAGNGAPVLSVSVHCPSCKDEFCGLCKKAYHPNISCDEFGRRLI--ADGQD 969
                     |..|                  |:.|||..|::.:||:.:||:..|:..  ..|.:
Zfish   222 ---------GREG------------------CETEFCYHCRQLWHPDQTCDQARRQRARHTSGAN 259

  Fly   970 DIGI-------PFDNELIKCCPMCAVPIEK--DEGCAQMMCKRCKHVFCWYCLASLDDDFLLRHY 1025
            |:..       |.|.|.||.||.|...|.|  |..|.:|.|..|...|||.|:..:.|   :.:.
Zfish   260 DVSTLYVFNEEPGDAEEIKPCPRCGAYIMKTNDGSCNRMNCTVCACQFCWLCMQEITD---VHYL 321

  Fly  1026 DKGPC----KNKLGHSRASVVWHRAQVIGIFAGFGILLLVASPLLLLAAPCII------CCKCRG 1080
            ....|    |.....:| .|:|....::|......::..:|.|::::..|..:      .||...
Zfish   322 SPSGCTFWGKKPWSQTR-KVLWQVGMLLGAPVVISLIAGIAIPVIIVGIPIYMGRKVHGRCKKNN 385

  Fly  1081 CTGSK 1085
            .:|||
Zfish   386 TSGSK 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33144NP_001188904.1 IBR 850..956 CDD:214763 21/106 (20%)
IBR <976..1014 CDD:279784 18/39 (46%)
si:ch211-278j3.3XP_696570.3 IBR 179..244 CDD:214763 21/106 (20%)
IBR <276..314 CDD:279784 16/37 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1815
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.