DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33144 and ANKIB1

DIOPT Version :10

Sequence 1:NP_788324.1 Gene:CG33144 / 36131 FlyBaseID:FBgn0053144 Length:1102 Species:Drosophila melanogaster
Sequence 2:NP_061877.1 Gene:ANKIB1 / 54467 HGNCID:22215 Length:1089 Species:Homo sapiens


Alignment Length:317 Identity:69/317 - (21%)
Similarity:114/317 - (35%) Gaps:91/317 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   741 CCVRDGIALKRREMLASADVTP---------SVGTPATPTTAFKPFT----------------CK 780
            ||.|.|:.:.          ||         ::.:|.||.|.....|                |.
Human   280 CCQRSGVQMP----------TPPPSGYNAWDTLPSPRTPRTTRSSVTSPDEISLSPGDLDTSLCD 334

  Fly   781 LCLIDVEDVGEAMALQQCGCQFCIECMRAYVEFEISEG-AYEISCPDATCPAQGAISLPEIANLT 844
            :|:..: .|.|......||..||..|..:::..:|.|| |:.|.||...|.....:.:  |.::.
Human   335 ICMCSI-SVFEDPVDMPCGHDFCRGCWESFLNLKIQEGEAHNIFCPAYDCFQLVPVDI--IESVV 396

  Fly   845 TTNLLKKHHRYRLNREIELDKTRTWCPRAGCETICTVGAAAQPGQSSVICQMDESPSTSQSYSPQ 909
            :..:.|::.::.:...:|.:....|||..||:....:                    |.|     
Human   397 SKEMDKRYLQFDIKAFVENNPAIKWCPTPGCDRAVRL--------------------TKQ----- 436

  Fly   910 QEVAGNGSTGAAAGNGAPVLSVSVHCPSCKDEFCGLCKKAYHPNISCDEFGRRL----------- 963
                |:.::|:...:...:.:.:|.|.. ...||..|....|....|..:...|           
Human   437 ----GSNTSGSDTLSFPLLRAPAVDCGK-GHLFCWECLGEAHEPCDCQTWKNWLQKITEMKPEEL 496

  Fly   964 --IADGQDDIGIPFDNEL-----IKCCPMCAVPIEKDEGCAQMMCKRCKHVFCWYCL 1013
              :::..:|..    |.|     .|.|..|..||:|:|||..|.|.:||:.|||.||
Human   497 VGVSEAYEDAA----NCLWLLTNSKPCANCKSPIQKNEGCNHMQCAKCKYDFCWICL 549

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33144NP_788324.1 mRING-HC-C4C4_RBR_RNF144 777..829 CDD:438294 17/68 (25%)
BRcat_RBR_RNF144 860..961 CDD:439010 17/100 (17%)
Rcat_RBR_RNF144 976..1045 CDD:439013 20/43 (47%)
ANKIB1NP_061877.1 ANKYR <14..200 CDD:440430
ANK 1 45..74
ANK repeat 47..76 CDD:293786
ANK repeat 78..142 CDD:293786
ANK repeat 144..175 CDD:293786
ANK 2 144..173
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 281..321 10/49 (20%)
TRIAD supradomain. /evidence=ECO:0000255|PROSITE-ProRule:PRU01221 329..569 58/258 (22%)
RING-HC_RBR_ANKIB1 331..388 CDD:438430 17/57 (30%)
BRcat_RBR_ANKIB1 409..487 CDD:439007 18/107 (17%)
Rcat_RBR_ANKIB1 508..569 CDD:439022 20/42 (48%)
Ariadne 584..>712 CDD:466073
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 776..821
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 889..912
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 927..964
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1026..1089
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.