DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33144 and rnf144ab

DIOPT Version :9

Sequence 1:NP_001188904.1 Gene:CG33144 / 36131 FlyBaseID:FBgn0053144 Length:1102 Species:Drosophila melanogaster
Sequence 2:XP_005160733.1 Gene:rnf144ab / 437000 ZFINID:ZDB-GENE-040718-486 Length:294 Species:Danio rerio


Alignment Length:334 Identity:143/334 - (42%)
Similarity:181/334 - (54%) Gaps:60/334 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   755 LASADVTPSVGTPATPTTAFKPFTCKLCLIDVEDVGEAMALQQCGCQFCIECMRAYVEFEISEG- 818
            ::|:...||......|.     .:|||||.:. .:.:...:.||.|.||..|::.|||..|.|| 
Zfish     1 MSSSRYEPSWDVDLAPL-----LSCKLCLGEF-PLEQMTTISQCQCIFCSLCLKQYVELLIKEGL 59

  Fly   819 AYEISCPDATCPAQGAISLPEIANLTTTNLLKKHHRYRLNREIELDKTRTWCPRAGCETICTVGA 883
            ...|||||:|||.||.:...||..:....:::.:.|.:..||:.||..|||||.:.|:       
Zfish    60 ETAISCPDSTCPKQGHLLENEIECMVAGEVMQHYKRLQFEREVLLDPCRTWCPSSSCQ------- 117

  Fly   884 AAQPGQSSVICQMDESPSTSQSYSPQQEVAGNGSTGAAAGNGAPVLSVSVHCPSCKDEFCGLCKK 948
                    .:||::|:           ||.               |...|.||.|...||..|:.
Zfish   118 --------AVCQLNEA-----------EVQ---------------LPQPVQCPECSLRFCSACRA 148

  Fly   949 AYHPNISCDEF--------GRRLIADGQDDIGIPFDNELIKCCPMCAVPIEKDEGCAQMMCKRCK 1005
            ..|...:|.|.        |.    :|..::....|...||.||.|.|.||:||||||||||.||
Zfish   149 DCHTGQACQEMLPITTFLPGE----NGSSNLKSQEDEAPIKRCPKCKVYIERDEGCAQMMCKNCK 209

  Fly  1006 HVFCWYCLASLDDDFLLRHYDKGPCKNKLGHSRASVVWHRAQVIGIFAGFGILLLVASPLLLLAA 1070
            |.||||||.||||||||.|||||||:||||||||||:|||.||:|||||||:|||||||.||||.
Zfish   210 HAFCWYCLESLDDDFLLIHYDKGPCRNKLGHSRASVIWHRTQVVGIFAGFGLLLLVASPFLLLAT 274

  Fly  1071 PCIICCKCR 1079
            |.::||||:
Zfish   275 PFVLCCKCK 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33144NP_001188904.1 IBR 850..956 CDD:214763 25/105 (24%)
IBR <976..1014 CDD:279784 27/37 (73%)
rnf144abXP_005160733.1 IBR 93..156 CDD:214763 25/103 (24%)
IBR <179..218 CDD:279784 27/38 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 120 1.000 Domainoid score I5724
eggNOG 1 0.900 - - E1_KOG1815
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002315
OrthoInspector 1 1.000 - - otm24505
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11685
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X336
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
87.870

Return to query results.
Submit another query.