DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33144 and rbck1

DIOPT Version :9

Sequence 1:NP_001188904.1 Gene:CG33144 / 36131 FlyBaseID:FBgn0053144 Length:1102 Species:Drosophila melanogaster
Sequence 2:NP_001002168.1 Gene:rbck1 / 431715 ZFINID:ZDB-GENE-040704-3 Length:515 Species:Danio rerio


Alignment Length:409 Identity:83/409 - (20%)
Similarity:130/409 - (31%) Gaps:113/409 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   639 EDDQRRAQEPHINVNAQI----------RLSGGATANSTSPSPPSNVTTATLHSSSANNLNQEPQ 693
            |.::|..:|..|:|..:.          |::.|.|..:..|.|......|....:..|...:...
Zfish   147 EQERREKEERQIDVIMETIERPLQRPPERITRGNTRPALPPKPKFLDGWACPQCTYLNKPTRPGC 211

  Fly   694 QSTSTPATTPTETPGSGELGPFGTNHAYPLTVSSLLSMASANQAAQACCVRDGIALKRR-EMLAS 757
            :..||......:.|...:.....|.......::||....|..|..:    |:.:..:|. |.|..
Zfish   212 EMCSTARPDNYQVPDLYQPDESETRRLQQEELASLQYEQSLLQEEE----RNFLERQRNYEELLQ 272

  Fly   758 ADVTPSVGTPATPTTAFKPFTCKLCLIDVEDVGEAMALQQCGCQFCIECMRAYVEFEISEGAYEI 822
            .|....||..       ....|.:|...:.. ||...|::|...||.:|::..|          :
Zfish   273 TDAHSLVGNT-------DQLECAICFGTIMP-GEGAVLRECLHSFCRDCLKGTV----------V 319

  Fly   823 SCPDA--TCP-------AQGAISLPEIANLTTTNLLKKHHRYRLNREIELDKTRTWCPRAGCETI 878
            :|.||  .||       ....:...||.:|.|.:..:|....|||......:....|....|...
Zfish   320 NCLDAEVCCPYGDNAYACNCKLQDREIKSLLTQDEYQKFLELRLNIAESRSENSYHCKTPDCAGW 384

  Fly   879 CTVGAAAQPGQSSVICQMDESPSTSQSYSPQQEVAGNGSTGAAAGNGAPVLSVSVHCPSCKDEFC 943
            |             |.:.|.:                                ...|..|.:..|
Zfish   385 C-------------IFEDDVN--------------------------------EFKCDICNETNC 404

  Fly   944 GLCKKAYHPNISCDEFGRRLIADGQDDIGIPFDN------------ELIK-----CCPMCAVPIE 991
            .|| ||.|..::|.|:        |||:.:...|            :|:|     .||.|.|.::
Zfish   405 LLC-KAIHKGMNCKEY--------QDDLRVRAQNDEAARQTTEMLDQLLKNGEAMNCPKCQVIVQ 460

  Fly   992 KDEGCAQMMCKRCKHVFCW 1010
            |.:||..:.|..||...||
Zfish   461 KKDGCDWICCLMCKTEICW 479

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33144NP_001188904.1 IBR 850..956 CDD:214763 17/105 (16%)
IBR <976..1014 CDD:279784 15/52 (29%)
rbck1NP_001002168.1 UBQ 62..136 CDD:320785
RanBP2-type Zn finger 195..214 CDD:275376 2/18 (11%)
RING_Ubox 283..337 CDD:327409 15/64 (23%)
IBR 356..409 CDD:307574 14/98 (14%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1815
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.