DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33144 and arih2

DIOPT Version :9

Sequence 1:NP_001188904.1 Gene:CG33144 / 36131 FlyBaseID:FBgn0053144 Length:1102 Species:Drosophila melanogaster
Sequence 2:NP_998308.1 Gene:arih2 / 406417 ZFINID:ZDB-GENE-040426-2158 Length:492 Species:Danio rerio


Alignment Length:373 Identity:84/373 - (22%)
Similarity:125/373 - (33%) Gaps:101/373 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   682 SSSANNLNQEPQQSTSTPATTPTETPGSGELGPFGTNHAYPLTV------------------SSL 728
            ||.|::.|:|.:..        .|..|.|::..:..|....:.|                  |..
Zfish     6 SSQASDSNEEFEDD--------DEDIGEGDIPHYYDNLEEDVAVEEPFDPEKYQFNCLTYRESQR 62

  Fly   729 LSMASANQAAQACCVRDGIA--------------LKR-----REMLASADVTPSVGTPATPTTAF 774
            :.....|..|.|..|...:|              |:|     .::|..|...|:  |.....||.
Zfish    63 VLTEQVNNVASALKVSPAVAKLVLVHFHWQVVQILERYKSNSSQLLCEAYAQPT--TTCRSLTAG 125

  Fly   775 KPFTCKLCLIDVEDVGEAMALQQCGCQFCIECMRAYVEFEISEG-AYEISCPDATCPAQGAISLP 838
            ....|.:||..|.  .:|:....|...||..|...:....:.:| ..||||....|    ::.:|
Zfish   126 TSLQCGVCLQLVR--RDALLSLPCQHSFCKGCWEQHCTVLVKDGVGVEISCMAQDC----SLRMP 184

  Fly   839 E---IANLTTTNLLKKHHRYRLNREIELDKTRTWCPRAGCETICTVGAAAQPGQSSVICQMDESP 900
            |   :..|.:..|..|:.||.....:|.......||.|.|               .::.|:.|  
Zfish   185 EDFVLPLLPSEELKDKYRRYLFRDYVESHFQLQLCPGADC---------------PIVIQVQE-- 232

  Fly   901 STSQSYSPQQEVAGNGSTGAAAGNGAPVLSVSVHCPSCKDEFCGLCKKAYHPNISCDEFGRRLIA 965
                   |:..                    .|.|..|::.||..|::.||....|....:.|..
Zfish   233 -------PRAR--------------------RVQCSRCEEVFCFKCRQMYHAPTDCATIRKWLTK 270

  Fly   966 DGQDDIGIPFDNELIKCCPMCAVPIEKDEGCAQMMCKRCKHVFCWYCL 1013
            ...|.....:.:...|.||.|.:.|||:.||..|.|.:|||.|||.||
Zfish   271 CADDSETANYISAHTKDCPKCNICIEKNGGCNHMQCSKCKHDFCWMCL 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33144NP_001188904.1 IBR 850..956 CDD:214763 19/105 (18%)
IBR <976..1014 CDD:279784 19/38 (50%)
arih2NP_998308.1 IBR 199..261 CDD:214763 19/105 (18%)
IBR <289..321 CDD:279784 17/30 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469819at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.