DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33144 and arih1l

DIOPT Version :9

Sequence 1:NP_001188904.1 Gene:CG33144 / 36131 FlyBaseID:FBgn0053144 Length:1102 Species:Drosophila melanogaster
Sequence 2:NP_998088.1 Gene:arih1l / 405859 ZFINID:ZDB-GENE-040426-2395 Length:533 Species:Danio rerio


Alignment Length:259 Identity:62/259 - (23%)
Similarity:97/259 - (37%) Gaps:68/259 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   767 PATPTTAFKPFTCKLCLIDVEDVGEAMALQQCGCQFCIECMRAYVEFE-ISEG-AYEISCPDATC 829
            |.:..::.:...|::|.::..:  ......:||.:||::|...|:..: |.|| ...||||...|
Zfish   150 PMSTRSSSQDLPCQICYLNYPN--SYFTGLECGHKFCMQCWGDYLTTKIIEEGMGQTISCPAHNC 212

  Fly   830 PAQGAISLPEIANLTTTNLLK-KHHRYRLNREIELDKTRTWCPRAGCETICTVGAAAQPGQSSVI 893
            ..  .:....:..|.|.:.:| |:.....|..:|.::...|||...|..:..|   ..|....|.
Zfish   213 DI--LVDDNTVMRLITDSKVKLKYQHLITNSFVECNRLLKWCPAPDCHHVVKV---QYPDAKPVR 272

  Fly   894 CQMDESPSTSQSYSPQQEVAGNGSTGAAAGNGAPVLSVSVHCPSCKDEFCGLCKKAYHPNISCDE 958
            |:                                          |..:||..|.:.:|..:.| :
Zfish   273 CK------------------------------------------CGRQFCFNCGENWHDPVKC-K 294

  Fly   959 FGRRLIADGQDDIGIPFDNEL-------IKCCPMCAVPIEKDEGCAQMMCK--RCKHVFCWYCL 1013
            :.|:.|....|      |:|.       .|.||.|.|.||||.||..|:|:  .||..|||.||
Zfish   295 WLRKWIKKCDD------DSETSNWIAANTKECPKCHVTIEKDGGCNHMVCRNQNCKAEFCWVCL 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33144NP_001188904.1 IBR 850..956 CDD:214763 17/106 (16%)
IBR <976..1014 CDD:279784 22/47 (47%)
arih1lNP_998088.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..35
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 48..73
TRIAD supradomain. /evidence=ECO:0000255|PROSITE-ProRule:PRU01221 158..369 61/251 (24%)
IBR 233..293 CDD:214763 16/104 (15%)
IBR <315..355 CDD:279784 20/38 (53%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1815
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469819at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.