DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33144 and CG12362

DIOPT Version :9

Sequence 1:NP_001188904.1 Gene:CG33144 / 36131 FlyBaseID:FBgn0053144 Length:1102 Species:Drosophila melanogaster
Sequence 2:NP_648392.1 Gene:CG12362 / 39193 FlyBaseID:FBgn0036082 Length:511 Species:Drosophila melanogaster


Alignment Length:260 Identity:67/260 - (25%)
Similarity:104/260 - (40%) Gaps:70/260 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   768 ATPTTAFKPFTCKLCLIDVEDVGEAMALQQCGCQFCIECMRAYVEFE-ISEG-AYEISCPDATCP 830
            |..|:...|..|.:|....:   |.:.| .||..||..|.:.|:..: .||| |..|.||.|.|.
  Fly   129 AASTSCAIPQLCGICFCSCD---ELIGL-GCGHNFCAACWKQYLANKTCSEGLANTIKCPAANCE 189

  Fly   831 -AQGAISLPEIANLTTTNLLKKHHRYRLNREIELDKTRTWCPRAGC----ETICTVGAAAQPGQS 890
             ....||..::|:  .:.:::::.:...|..:|.:....|||...|    :.:|     |:|  .
  Fly   190 ILVDYISFLKLAD--DSEVVERYQQLITNTFVECNMLMRWCPAPNCSHAVKAVC-----AEP--R 245

  Fly   891 SVICQMDESPSTSQSYSPQQEVAGNGSTGAAAGNGAPVLSVSVHCPSCKDEFCGLCKKAYHPNIS 955
            :|:|:                                          |..|||..|.:.:|...|
  Fly   246 AVLCK------------------------------------------CGHEFCFACGENWHEPAS 268

  Fly   956 CD---EFGRRLIADGQDDIGIPFDNELIKCCPMCAVPIEKDEGCAQMMCKR--CKHVFCWYCLAS 1015
            |.   ::.::.:.|.:....|.   :..|.||.|.|.||||.||..|:||.  |::.|||.||.|
  Fly   269 CSSLKKWVKKCLEDSETSNWIA---QNTKECPKCNVTIEKDGGCNHMVCKNPSCRYDFCWVCLGS 330

  Fly  1016  1015
              Fly   331  330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33144NP_001188904.1 IBR 850..956 CDD:214763 17/109 (16%)
IBR <976..1014 CDD:279784 19/39 (49%)
CG12362NP_648392.1 IBR 208..269 CDD:214763 17/109 (16%)
IBR 273..331 CDD:279784 23/61 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1815
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469819at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11685
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.