DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33144 and ari-2

DIOPT Version :9

Sequence 1:NP_001188904.1 Gene:CG33144 / 36131 FlyBaseID:FBgn0053144 Length:1102 Species:Drosophila melanogaster
Sequence 2:NP_477374.1 Gene:ari-2 / 37542 FlyBaseID:FBgn0025186 Length:509 Species:Drosophila melanogaster


Alignment Length:252 Identity:61/252 - (24%)
Similarity:94/252 - (37%) Gaps:54/252 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   766 TPATPTTAFKPFTCKLCLIDVEDVGEAMALQQCGCQFCIECMRAYVEFEISEG-AYEISCPDATC 829
            |.|:.|..::...|.:|.  ...:|:......||..||.:|...|.|.:|.:| :.:|.|....|
  Fly   140 TTASATPQYRSQMCPVCA--SSQLGDKFYSLACGHSFCKDCWTIYFETQIFQGISTQIGCMAQMC 202

  Fly   830 PAQGAISLPE--IANLTTTNLLK-KHHRYRLNREIELDKTRTWCPRAGCETICTVGAAAQPGQSS 891
                .:.:||  :..|.|..::: |:.::.....::......:||...|:.|.         |||
  Fly   203 ----NVRVPEDLVLTLVTRPVMRDKYQQFAFKDYVKSHPELRFCPGPNCQIIV---------QSS 254

  Fly   892 VICQMDESPSTSQSYSPQQEVAGNGSTGAAAGNGAPVLSVSVHCPSCKDEFCGLCKKAYHPNISC 956
            .|             |.::.:                      |.:|...||..|...||....|
  Fly   255 EI-------------SAKRAI----------------------CKACHTGFCFRCGMDYHAPTDC 284

  Fly   957 DEFGRRLIADGQDDIGIPFDNELIKCCPMCAVPIEKDEGCAQMMCKRCKHVFCWYCL 1013
            ....:.|.....|.....:.:...|.||.|.:.|||:.||..|.|..|||.|||.||
  Fly   285 QVIKKWLTKCADDSETANYISAHTKDCPKCHICIEKNGGCNHMQCFNCKHDFCWMCL 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33144NP_001188904.1 IBR 850..956 CDD:214763 17/106 (16%)
IBR <976..1014 CDD:279784 19/38 (50%)
ari-2NP_477374.1 RING-HC_RBR_TRIAD1 151..204 CDD:319687 15/58 (26%)
IBR 222..284 CDD:214763 17/105 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469819at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11685
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.