DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33144 and ari-2

DIOPT Version :10

Sequence 1:NP_788324.1 Gene:CG33144 / 36131 FlyBaseID:FBgn0053144 Length:1102 Species:Drosophila melanogaster
Sequence 2:NP_477374.1 Gene:ari-2 / 37542 FlyBaseID:FBgn0025186 Length:509 Species:Drosophila melanogaster


Alignment Length:252 Identity:61/252 - (24%)
Similarity:94/252 - (37%) Gaps:54/252 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   766 TPATPTTAFKPFTCKLCLIDVEDVGEAMALQQCGCQFCIECMRAYVEFEISEG-AYEISCPDATC 829
            |.|:.|..::...|.:|.  ...:|:......||..||.:|...|.|.:|.:| :.:|.|....|
  Fly   140 TTASATPQYRSQMCPVCA--SSQLGDKFYSLACGHSFCKDCWTIYFETQIFQGISTQIGCMAQMC 202

  Fly   830 PAQGAISLPE--IANLTTTNLLK-KHHRYRLNREIELDKTRTWCPRAGCETICTVGAAAQPGQSS 891
                .:.:||  :..|.|..::: |:.::.....::......:||...|:.|.         |||
  Fly   203 ----NVRVPEDLVLTLVTRPVMRDKYQQFAFKDYVKSHPELRFCPGPNCQIIV---------QSS 254

  Fly   892 VICQMDESPSTSQSYSPQQEVAGNGSTGAAAGNGAPVLSVSVHCPSCKDEFCGLCKKAYHPNISC 956
            .|             |.::.:                      |.:|...||..|...||....|
  Fly   255 EI-------------SAKRAI----------------------CKACHTGFCFRCGMDYHAPTDC 284

  Fly   957 DEFGRRLIADGQDDIGIPFDNELIKCCPMCAVPIEKDEGCAQMMCKRCKHVFCWYCL 1013
            ....:.|.....|.....:.:...|.||.|.:.|||:.||..|.|..|||.|||.||
  Fly   285 QVIKKWLTKCADDSETANYISAHTKDCPKCHICIEKNGGCNHMQCFNCKHDFCWMCL 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33144NP_788324.1 mRING-HC-C4C4_RBR_RNF144 777..829 CDD:438294 14/52 (27%)
BRcat_RBR_RNF144 860..961 CDD:439010 17/100 (17%)
Rcat_RBR_RNF144 976..1045 CDD:439013 19/38 (50%)
ari-2NP_477374.1 RING-HC_RBR_TRIAD1 152..204 CDD:438429 15/57 (26%)
BRcat_RBR_TRIAD1 231..302 CDD:439005 19/114 (17%)
Rcat_RBR_TRIAD1 306..361 CDD:439021 19/36 (53%)
Ariadne 371..>477 CDD:466073
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.