DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33144 and Ankib1

DIOPT Version :9

Sequence 1:NP_001188904.1 Gene:CG33144 / 36131 FlyBaseID:FBgn0053144 Length:1102 Species:Drosophila melanogaster
Sequence 2:XP_006236111.1 Gene:Ankib1 / 368062 RGDID:1597088 Length:1091 Species:Rattus norvegicus


Alignment Length:316 Identity:76/316 - (24%)
Similarity:118/316 - (37%) Gaps:89/316 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   741 CCVRDGIALKRREMLA-------SADVTPSVGTPATPTTAFKPFT----------------CKLC 782
            ||.|.|:     :|.|       :.|..||   |.||.|.....|                |.:|
  Rat   281 CCQRSGV-----QMPAPPPSGCNAWDTLPS---PRTPRTTRSSVTSPDEISLSPGDLDTSLCDIC 337

  Fly   783 LIDVEDVGEAMALQQCGCQFCIECMRAYVEFEISEG-AYEISCPDATCPAQGAISLPEIANLTTT 846
            :..: .|.|......||..||..|..:::..:|.|| |:.|.||...|  ...:.:..|.::.:.
  Rat   338 MCSI-SVFEDPVDMPCGHDFCRGCWESFLNLKIQEGEAHNIFCPAYEC--FQLVPVDVIESVVSK 399

  Fly   847 NLLKKHHRYRLNREIELDKTRTWCPRAGCETICTVGAAAQPGQSSVICQMDESPSTSQSYSPQQE 911
            .:.|::.::.:...:|.:....|||.||||            ::..:.:...:||.|.:.|    
  Rat   400 EMDKRYLQFDIKAFVENNPAIKWCPTAGCE------------RAVRLTKQGSNPSGSDTLS---- 448

  Fly   912 VAGNGSTGAAAGNGAPVL-SVSVHCPSCKDEFCGLCKKAYHPNISCDEFGRRL------------ 963
                          .|:| :.:|.|.. ...||..|....|....|..:...|            
  Rat   449 --------------FPLLRAPAVDCGK-GHLFCWECLGEAHEPCDCQTWKNWLQKITEMKPEELV 498

  Fly   964 -IADGQDDIGIPFDNEL-----IKCCPMCAVPIEKDEGCAQMMCKRCKHVFCWYCL 1013
             :::..:|..    |.|     .|.|..|..||:|:|||..|.|.:||:.|||.||
  Rat   499 GVSEAYEDAA----NCLWLLTNSKPCANCKSPIQKNEGCNHMQCAKCKYDFCWICL 550

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33144NP_001188904.1 IBR 850..956 CDD:214763 21/106 (20%)
IBR <976..1014 CDD:279784 20/43 (47%)
Ankib1XP_006236111.1 ANK repeat 47..77 CDD:293786
Ank_2 50..176 CDD:403870
ANK repeat 79..143 CDD:293786
ANK repeat 145..176 CDD:293786
RING-HC_RBR_ANKIB1 333..389 CDD:319688 17/58 (29%)
IBR 403..476 CDD:396187 21/103 (20%)
IBR 502..553 CDD:396187 21/53 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1815
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469819at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.