DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33144 and Arih2

DIOPT Version :9

Sequence 1:NP_001188904.1 Gene:CG33144 / 36131 FlyBaseID:FBgn0053144 Length:1102 Species:Drosophila melanogaster
Sequence 2:NP_001012275.1 Gene:Arih2 / 316005 RGDID:1305839 Length:492 Species:Rattus norvegicus


Alignment Length:388 Identity:90/388 - (23%)
Similarity:129/388 - (33%) Gaps:88/388 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   650 INVNAQIRLSGGATANSTSPSP-----------PSNV------TTATLHSSSANNLNQEPQQSTS 697
            :::|:|     |:.:|.....|           |.::      ..:.:....|:..:.|..|.|.
  Rat     3 VDMNSQ-----GSDSNEEDYDPNCEEEEEEEEDPGDIEDYYVGVASDVEQQGADAFDPEEYQFTC 62

  Fly   698 TPATTPTETPGSGELGPFGTNHAYPLTVS-SLLSMASANQAAQACCVRDGIALKRREMLASADV- 760
            .     |.....|.|....|:.|..|.|| |:..:...|...|...:.|.......::|..|.| 
  Rat    63 L-----TYKESEGALHEHMTSLASALKVSHSVAKLILVNFHWQVSEILDRYRSNSAQLLVEARVQ 122

  Fly   761 -TPSVGTPATPTTAFKPFTCKLCLIDVEDVGEAMALQQCGCQFCIECMRAYVEFEISEG-AYEIS 823
             .||...|    ||..|..|.:|:..|..  |.:....|..|||..|...:....:.:| ...||
  Rat   123 PNPSKHVP----TAHPPHHCAVCMQFVRK--ENLLSLTCQHQFCRSCWEQHCSVLVKDGVGVGIS 181

  Fly   824 CPDATCPAQGAISLPE---IANLTTTNLLKKHHRYRLNREIELDKTRTWCPRAGCETICTVGAAA 885
            |....||    :..||   ...|....|..|:.||.....:|.......||.|.|..:..|    
  Rat   182 CMAQDCP----LRTPEDFVFPLLPNEELRDKYRRYLFRDYVESHYQLQLCPGADCPMVIRV---- 238

  Fly   886 QPGQSSVICQMDESPSTSQSYSPQQEVAGNGSTGAAAGNGAPVLSVSVHCPSCKDEFCGLCKKAY 950
                        :.|...:                            |.|..|.:.||..|::.|
  Rat   239 ------------QEPRARR----------------------------VQCNRCNEVFCFKCRQMY 263

  Fly   951 HPNISCDEFGRRLIADGQDDIGIPFDNELIKCCPMCAVPIEKDEGCAQMMCKRCKHVFCWYCL 1013
            |....|....:.|.....|.....:.:...|.||.|.:.|||:.||..|.|.:|||.|||.||
  Rat   264 HAPTDCATIRKWLTKCADDSETANYISAHTKDCPKCNICIEKNGGCNHMQCSKCKHDFCWMCL 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33144NP_001188904.1 IBR 850..956 CDD:214763 18/105 (17%)
IBR <976..1014 CDD:279784 19/38 (50%)
Arih2NP_001012275.1 RING-HC_RBR_TRIAD1 136..189 CDD:319687 15/58 (26%)
IBR 207..269 CDD:214763 18/105 (17%)
IBR <297..329 CDD:396187 17/30 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469819at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.