DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33144 and Arih1

DIOPT Version :9

Sequence 1:NP_001188904.1 Gene:CG33144 / 36131 FlyBaseID:FBgn0053144 Length:1102 Species:Drosophila melanogaster
Sequence 2:NP_001013126.2 Gene:Arih1 / 300756 RGDID:1308131 Length:555 Species:Rattus norvegicus


Alignment Length:248 Identity:60/248 - (24%)
Similarity:93/248 - (37%) Gaps:70/248 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   779 CKLCLIDVEDVGEAMALQQCGCQFCIECMRAYVEFEISEGAYEISCPDATCPAQGAISLPE---I 840
            |::|.::..:  ......:||.:||::|...|:..:|.|   |......:|||.|...|.:   :
  Rat   184 CQICYLNYPN--SYFTGLECGHKFCMQCWSEYLTTKIME---EGMGQTISCPAHGCDILVDDNTV 243

  Fly   841 ANLTTTNLLK-KHHRYRLNREIELDKTRTWCPRAGCETICTVGAAAQPGQSSVICQMDESPSTSQ 904
            ..|.|.:.:| |:.....|..:|.::...|||...|..:..|   ..|....|.|:         
  Rat   244 MRLITDSKVKLKYQHLITNSFVECNRLLKWCPAPDCHHVVKV---QYPDAKPVRCK--------- 296

  Fly   905 SYSPQQEVAGNGSTGAAAGNGAPVLSVSVHCPSCKDEFCGLCKKAYHPNISCDEFGRRLIADGQD 969
                                             |..:||..|.:.:|..:.| ::.::.|....|
  Rat   297 ---------------------------------CGRQFCFNCGENWHDPVKC-KWLKKWIKKCDD 327

  Fly   970 DIGIPFDNEL-------IKCCPMCAVPIEKDEGCAQMMCK--RCKHVFCWYCL 1013
                  |:|.       .|.||.|.|.||||.||..|:|:  .||..|||.||
  Rat   328 ------DSETSNWIAANTKECPKCHVTIEKDGGCNHMVCRNQNCKAEFCWVCL 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33144NP_001188904.1 IBR 850..956 CDD:214763 17/106 (16%)
IBR <976..1014 CDD:279784 22/47 (47%)
Arih1NP_001013126.2 RING-HC_RBR_HHARI 183..240 CDD:319540 16/60 (27%)
IBR 255..315 CDD:214763 16/104 (15%)
IBR <337..377 CDD:396187 20/38 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1815
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469819at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.