DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33144 and ARIH1

DIOPT Version :9

Sequence 1:NP_001188904.1 Gene:CG33144 / 36131 FlyBaseID:FBgn0053144 Length:1102 Species:Drosophila melanogaster
Sequence 2:NP_005735.2 Gene:ARIH1 / 25820 HGNCID:689 Length:557 Species:Homo sapiens


Alignment Length:248 Identity:60/248 - (24%)
Similarity:93/248 - (37%) Gaps:70/248 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   779 CKLCLIDVEDVGEAMALQQCGCQFCIECMRAYVEFEISEGAYEISCPDATCPAQGAISLPE---I 840
            |::|.::..:  ......:||.:||::|...|:..:|.|   |......:|||.|...|.:   :
Human   186 CQICYLNYPN--SYFTGLECGHKFCMQCWSEYLTTKIME---EGMGQTISCPAHGCDILVDDNTV 245

  Fly   841 ANLTTTNLLK-KHHRYRLNREIELDKTRTWCPRAGCETICTVGAAAQPGQSSVICQMDESPSTSQ 904
            ..|.|.:.:| |:.....|..:|.::...|||...|..:..|   ..|....|.|:         
Human   246 MRLITDSKVKLKYQHLITNSFVECNRLLKWCPAPDCHHVVKV---QYPDAKPVRCK--------- 298

  Fly   905 SYSPQQEVAGNGSTGAAAGNGAPVLSVSVHCPSCKDEFCGLCKKAYHPNISCDEFGRRLIADGQD 969
                                             |..:||..|.:.:|..:.| ::.::.|....|
Human   299 ---------------------------------CGRQFCFNCGENWHDPVKC-KWLKKWIKKCDD 329

  Fly   970 DIGIPFDNEL-------IKCCPMCAVPIEKDEGCAQMMCK--RCKHVFCWYCL 1013
                  |:|.       .|.||.|.|.||||.||..|:|:  .||..|||.||
Human   330 ------DSETSNWIAANTKECPKCHVTIEKDGGCNHMVCRNQNCKAEFCWVCL 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33144NP_001188904.1 IBR 850..956 CDD:214763 17/106 (16%)
IBR <976..1014 CDD:279784 22/47 (47%)
ARIH1NP_005735.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..95
UBA-like. /evidence=ECO:0000305|PubMed:23707686 105..153
TRIAD supradomain. /evidence=ECO:0000255|PROSITE-ProRule:PRU01221 182..393 60/248 (24%)
RING-HC_RBR_HHARI 185..242 CDD:319540 16/60 (27%)
IBR 257..317 CDD:214763 16/104 (15%)
IBR <339..379 CDD:396187 20/38 (53%)
Ariadne domain. /evidence=ECO:0000305|PubMed:23707686 408..557
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1815
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469819at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.