DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33144 and RNF144B

DIOPT Version :9

Sequence 1:NP_001188904.1 Gene:CG33144 / 36131 FlyBaseID:FBgn0053144 Length:1102 Species:Drosophila melanogaster
Sequence 2:NP_877434.2 Gene:RNF144B / 255488 HGNCID:21578 Length:303 Species:Homo sapiens


Alignment Length:348 Identity:150/348 - (43%)
Similarity:189/348 - (54%) Gaps:71/348 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   751 RREMLASADVTPSVG--TPATPTTAFKP-FTCKLCLIDVEDVGEAMALQQCGCQFCIECMRAYVE 812
            |...||.....|:.|  .||       | .||||||.: :.:.:...||:|.|.||..|::.|::
Human     6 RLHYLAMTAENPTPGDLAPA-------PLITCKLCLCE-QSLDKMTTLQECQCIFCTACLKQYMQ 62

  Fly   813 FEISEG-AYEISCPDATCPAQGAISLPEIANLTTTNLLKKHHRYRLNREIELDKTRTWCPRAGCE 876
            ..|.|| ...|:|||..|...|.:...|||.|...:..:.:.|.:..||:.||..|||||.|.|:
Human    63 LAIREGCGSPITCPDMVCLNHGTLQEAEIACLVPVDQFQLYQRLKFEREVHLDPYRTWCPVADCQ 127

  Fly   877 TICTVGAAAQPGQSSVICQMDESPSTSQSYSPQQEVAGNGSTGAAAGNGAPVLSVSVHCPSCKDE 941
            |:|.| |::.|||                                     |||   |.||||..:
Human   128 TVCPV-ASSDPGQ-------------------------------------PVL---VECPSCHLK 151

  Fly   942 FCGLCKKAYHPNISCDEFGRRLIADGQDDIGIPFDNEL---------IKCCPMCAVPIEKDEGCA 997
            ||..||.|:|..:||        .|.| .|.:|.::..         ||.||:|.|.||::||||
Human   152 FCSCCKDAWHAEVSC--------RDSQ-PIVLPTEHRALFGTDAEAPIKQCPVCRVYIERNEGCA 207

  Fly   998 QMMCKRCKHVFCWYCLASLDDDFLLRHYDKGPCKNKLGHSRASVVWHRAQVIGIFAGFGILLLVA 1062
            |||||.|||.||||||.:||:|..|||||||||:||||||||||:|:|.||:||..|.||:.||.
Human   208 QMMCKNCKHTFCWYCLQNLDNDIFLRHYDKGPCRNKLGHSRASVMWNRTQVVGILVGLGIIALVT 272

  Fly  1063 SPLLLLAAPCIICCKCRGCTGSK 1085
            |||||||:||||||.|:.|.|.|
Human   273 SPLLLLASPCIICCVCKSCRGKK 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33144NP_001188904.1 IBR 850..956 CDD:214763 33/105 (31%)
IBR <976..1014 CDD:279784 25/46 (54%)
RNF144BNP_877434.2 TRIAD supradomain. /evidence=ECO:0000255|PROSITE-ProRule:PRU01221 26..244 106/268 (40%)
mRING-HC-C4C4_RBR_RNF144B 28..84 CDD:319692 22/56 (39%)
IBR 101..166 CDD:214763 33/105 (31%)
IBR <190..225 CDD:396187 26/34 (76%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 72 1.000 Domainoid score I9345
eggNOG 1 0.900 - - E1_KOG1815
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002315
OrthoInspector 1 1.000 - - otm41301
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR11685
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X336
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
98.870

Return to query results.
Submit another query.