DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33144 and SPAC328.02

DIOPT Version :9

Sequence 1:NP_001188904.1 Gene:CG33144 / 36131 FlyBaseID:FBgn0053144 Length:1102 Species:Drosophila melanogaster
Sequence 2:NP_594204.1 Gene:SPAC328.02 / 2543148 PomBaseID:SPAC328.02 Length:504 Species:Schizosaccharomyces pombe


Alignment Length:282 Identity:74/282 - (26%)
Similarity:107/282 - (37%) Gaps:73/282 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   778 TCKLCLIDVEDVG-EAMALQQCGCQFCIECMRAYVEFEISEGAYEISCPDATCPAQGAISLPEIA 841
            ||::|.    |.| ......:|..:||:.|.|.|::..||||...|.||:.:|..  .:|:..|.
pombe   130 TCEICY----DEGCLPFFSAECDHEFCLACYRQYLDSRISEGESVIQCPEESCTQ--IVSIQSIT 188

  Fly   842 NLTTTNLLKKHHRYRLNREIELDKTR-TWCPRAGCETI--CTVGAAAQPGQSSVICQMDESPSTS 903
            .:.....|.::||. |:|....|... .|||...||..  |.|   .|...|||:          
pombe   189 KVLDEKSLDRYHRL-LDRSFVDDNDHLRWCPAPDCEFAIECHV---TQASLSSVV---------- 239

  Fly   904 QSYSPQQEVAGNGSTGAAAGNGAPVLSVSVHCPSCKDEFCGLCKKAYHPNISCDEFGRRLIADGQ 968
                                       .:|.| :|..:||..|....|....| ...:..:...|
pombe   240 ---------------------------PTVTC-NCGKQFCFGCGHDNHQPTIC-PLVKIWLQKCQ 275

  Fly   969 DDIGIPFDNEL-------IKCCPMCAVPIEKDEGCAQMMCKRCKHVFCWYCLASLDDD----FLL 1022
            |      |:|.       .|.||.|:..|||:.||..|.||:||:.|||.||....:.    :..
pombe   276 D------DSETANWIHANTKECPKCSTTIEKNGGCNHMTCKKCKYEFCWVCLGPWTEHGNNWYTC 334

  Fly  1023 RHYDK---GPCKNKLGHSRASV 1041
            ..|::   ...::....||||:
pombe   335 NRYEEKSSTSARDSQSKSRASL 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33144NP_001188904.1 IBR 850..956 CDD:214763 23/108 (21%)
IBR <976..1014 CDD:279784 20/44 (45%)
SPAC328.02NP_594204.1 zf-C3HC4 131..175 CDD:278524 16/47 (34%)
IBR 197..264 CDD:214763 23/108 (21%)
IBR <285..324 CDD:279784 19/38 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1815
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.