DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33144 and Arih1

DIOPT Version :9

Sequence 1:NP_001188904.1 Gene:CG33144 / 36131 FlyBaseID:FBgn0053144 Length:1102 Species:Drosophila melanogaster
Sequence 2:NP_064311.2 Gene:Arih1 / 23806 MGIID:1344363 Length:555 Species:Mus musculus


Alignment Length:248 Identity:60/248 - (24%)
Similarity:93/248 - (37%) Gaps:70/248 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   779 CKLCLIDVEDVGEAMALQQCGCQFCIECMRAYVEFEISEGAYEISCPDATCPAQGAISLPE---I 840
            |::|.::..:  ......:||.:||::|...|:..:|.|   |......:|||.|...|.:   :
Mouse   184 CQICYLNYPN--SYFTGLECGHKFCMQCWSEYLTTKIME---EGMGQTISCPAHGCDILVDDNTV 243

  Fly   841 ANLTTTNLLK-KHHRYRLNREIELDKTRTWCPRAGCETICTVGAAAQPGQSSVICQMDESPSTSQ 904
            ..|.|.:.:| |:.....|..:|.::...|||...|..:..|   ..|....|.|:         
Mouse   244 MRLITDSKVKLKYQHLITNSFVECNRLLKWCPAPDCHHVVKV---QYPDAKPVRCK--------- 296

  Fly   905 SYSPQQEVAGNGSTGAAAGNGAPVLSVSVHCPSCKDEFCGLCKKAYHPNISCDEFGRRLIADGQD 969
                                             |..:||..|.:.:|..:.| ::.::.|....|
Mouse   297 ---------------------------------CGRQFCFNCGENWHDPVKC-KWLKKWIKKCDD 327

  Fly   970 DIGIPFDNEL-------IKCCPMCAVPIEKDEGCAQMMCK--RCKHVFCWYCL 1013
                  |:|.       .|.||.|.|.||||.||..|:|:  .||..|||.||
Mouse   328 ------DSETSNWIAANTKECPKCHVTIEKDGGCNHMVCRNQNCKAEFCWVCL 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33144NP_001188904.1 IBR 850..956 CDD:214763 17/106 (16%)
IBR <976..1014 CDD:279784 22/47 (47%)
Arih1NP_064311.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..93
UBA-like. /evidence=ECO:0000250|UniProtKB:Q9Y4X5 103..151
TRIAD supradomain. /evidence=ECO:0000255|PROSITE-ProRule:PRU01221 180..391 60/248 (24%)
RING-HC_RBR_HHARI 183..240 CDD:319540 16/60 (27%)
IBR 255..315 CDD:214763 16/104 (15%)
IBR <337..377 CDD:396187 20/38 (53%)
Ariadne domain. /evidence=ECO:0000250|UniProtKB:Q9Y4X5 406..555
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1815
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469819at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.