DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33144 and ari-1.2

DIOPT Version :9

Sequence 1:NP_001188904.1 Gene:CG33144 / 36131 FlyBaseID:FBgn0053144 Length:1102 Species:Drosophila melanogaster
Sequence 2:NP_491748.1 Gene:ari-1.2 / 172283 WormBaseID:WBGene00016157 Length:497 Species:Caenorhabditis elegans


Alignment Length:310 Identity:71/310 - (22%)
Similarity:106/310 - (34%) Gaps:95/310 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   719 HAYPLTVSSLLSMASANQAAQACCVRDGIALKRREMLASADVTPSVGTPATPTTAFKPFTCKLCL 783
            |.|.....|||.....:....|..:...:..:::|::.:.|.                 .|.:|.
 Worm    88 HKYKWNKESLLERLYEHPDTIAFLIDAQVIPRQQEVIPAGDA-----------------ECDICC 135

  Fly   784 IDVEDVGEAMALQQCGCQFCIECMRAYVEFEI-SEGAYEISCPDATCPAQGAISLPE----IANL 843
                .:.|...| .|..:.|.||.:||:..:| |:...||.|....|..     |.|    :|.:
 Worm   136 ----SMDELSGL-SCNHRACAECWQAYLTNKIVSDAQSEIECMAPNCKL-----LIEDEKVLAYI 190

  Fly   844 TTTNLLKKHHRYRLNREIELDKTRTWCPRAGCETICTVGAAAQPGQSSVICQMDESPSTSQSYSP 908
            ....::.|:.:..:...||::....|||...|                                 
 Worm   191 KDPTIIAKYRKMMVASYIEINALLKWCPGVDC--------------------------------- 222

  Fly   909 QQEVAGNGSTGAAAGNGAPVLSVSVHCPSCKDEFCGLCKKAYHPNISCDEFGRRLIA-------- 965
                   |.| ....:|.|.|.|   | :|...||..|.:.:|..::|     ||:.        
 Worm   223 -------GRT-VKVSHGEPRLVV---C-TCGSRFCFSCGQDWHEPVNC-----RLLKLWMKKCND 270

  Fly   966 DGQDDIGIPFDNELIKCCPMCAVPIEKDEGCAQMMCKR--CKHVFCWYCL 1013
            |.:....|   |...|.||.|...|||:.||.|:.||.  ||..|||.||
 Worm   271 DSETSNWI---NSNTKECPKCMATIEKNGGCNQITCKNTGCKFQFCWMCL 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33144NP_001188904.1 IBR 850..956 CDD:214763 19/105 (18%)
IBR <976..1014 CDD:279784 20/40 (50%)
ari-1.2NP_491748.1 IBR 197..258 CDD:214763 19/105 (18%)
IBR <279..320 CDD:279784 20/39 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469819at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.