DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33144 and ari-1.3

DIOPT Version :9

Sequence 1:NP_001188904.1 Gene:CG33144 / 36131 FlyBaseID:FBgn0053144 Length:1102 Species:Drosophila melanogaster
Sequence 2:NP_001379539.1 Gene:ari-1.3 / 172282 WormBaseID:WBGene00016156 Length:491 Species:Caenorhabditis elegans


Alignment Length:325 Identity:70/325 - (21%)
Similarity:118/325 - (36%) Gaps:84/325 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   719 HAYPLTVSSLLSMASANQAAQACCVRDGIALKRREMLASADVTPSVGTPATPTTAFKPFTCKLCL 783
            |.|.....|||.....:....|..:...:..:::|::.:.|.                 .|.:|.
 Worm    83 HKYKWNKESLLERFYEHPDTIAFLIDAQVIPRQQEVIPAGDA-----------------ECDICC 130

  Fly   784 IDVEDVGEAMALQQCGCQFCIECMRAYVEFEI-SEGAYEISCPDATCPAQGAISLPE----IANL 843
                .:.|...| .|..:.|.||.:||:..:| |:...||.|....|..     |.|    ::.:
 Worm   131 ----SMDELSGL-SCNHRACAECWQAYLTNKIVSDAQSEIECMAPNCKL-----LIEDEKVLSYI 185

  Fly   844 TTTNLLKKHHRYRLNREIELDKTRTWCPRAGCETICTVGAAAQPGQSSVICQMDESPSTSQSYSP 908
            :...::.|:.:..:...:|::....|||...|      |.|.:...                :.|
 Worm   186 SDPTMVSKYRKLMVASYVEINCLLRWCPGIDC------GKAVKVSH----------------WEP 228

  Fly   909 QQEVAGNGSTGAAAGNGAPVLSVSVHCPSCKDEFCGLCKKAYHPNISCDEFGRRLIADGQDDI-G 972
            :..|..                    |.:|   ||..|.:.:|..::|... ::.|...|||. .
 Worm   229 RLVVCS--------------------CGTC---FCFSCGQNWHEPLNCRHL-KKWIKKCQDDSET 269

  Fly   973 IPFDNELIKCCPMCAVPIEKDEGCAQMMCKR--CKHVFCWYCLASLDD---DFLLRHYDKGPCKN 1032
            :.:.|...|.||.|.:||||:.||.:|:|..  |::.|||.||.....   .:....||:...||
 Worm   270 MNWINANTKDCPKCMIPIEKNGGCNRMLCTNSGCRYEFCWMCLEPWTKHGYQYACNGYDETAVKN 334

  Fly  1033  1032
             Worm   335  334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33144NP_001188904.1 IBR 850..956 CDD:214763 16/105 (15%)
IBR <976..1014 CDD:279784 18/39 (46%)
ari-1.3NP_001379539.1 RING_Ubox 125..178 CDD:418438 17/62 (27%)
RING-HC finger (C3HC4-type) 126..172 CDD:319361 15/50 (30%)
IBR 193..253 CDD:214763 16/104 (15%)
IBR <274..315 CDD:396187 19/40 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1815
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469819at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.