DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33144 and ankib1

DIOPT Version :9

Sequence 1:NP_001188904.1 Gene:CG33144 / 36131 FlyBaseID:FBgn0053144 Length:1102 Species:Drosophila melanogaster
Sequence 2:XP_012821068.1 Gene:ankib1 / 100145487 XenbaseID:XB-GENE-1002083 Length:1063 Species:Xenopus tropicalis


Alignment Length:318 Identity:67/318 - (21%)
Similarity:116/318 - (36%) Gaps:93/318 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   741 CCVRDGIALKRREMLASADVTP---------SVGTPATPTTAFKPFT----------------CK 780
            ||.|.|:.:.          ||         ::.:|.||.|.....|                |.
 Frog   281 CCQRSGVQMP----------TPPPSGYNAWDTLPSPRTPRTTRSSVTSPDEISLSPGDIDTPLCG 335

  Fly   781 LCLIDV---EDVGEAMALQQCGCQFCIECMRAYVEFEISEG-AYEISCPDATCPAQGAISLPEIA 841
            :|:.::   ||..|.    .||.:||..|..:::..:|.|| |:.|.||...|  ...:.:..|.
 Frog   336 ICMCNISVFEDPVEI----PCGHEFCRVCWESFLNLKIQEGEAHNIFCPAYDC--FQLVPVDVIE 394

  Fly   842 NLTTTNLLKKHHRYRLNREIELDKTRTWCPRAGCETICTV--GAAAQPGQSSVICQMDESPSTSQ 904
            ::.:..:.|::.::.:...:|.:....|||...||....:  ......|..::...:..:|:.. 
 Frog   395 SVVSKEMDKRYLQFDIKAFVENNTAIRWCPTPACERAVRLKKQGTNTSGSDTLTFPLLRAPAVD- 458

  Fly   905 SYSPQQEVAGNGSTGAAAGNGAPVLSVSVHCPSCKDEFCGLCKKAYHPNISCDEFGRRL--IADG 967
                    .|.|..                       ||..|....|....|:.:...|  :::.
 Frog   459 --------CGKGHL-----------------------FCWECLGEAHEPCDCETWKNWLQKVSEM 492

  Fly   968 QDD--IGI--PFDNEL--------IKCCPMCAVPIEKDEGCAQMMCKRCKHVFCWYCL 1013
            :.:  :|:  .|::..        .|.|..|..||:|:|||..|.|.:||:.|||.||
 Frog   493 KPEELVGVSEAFEDAANCLWLLTNSKPCANCKSPIQKNEGCNHMQCAKCKYDFCWICL 550

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33144NP_001188904.1 IBR 850..956 CDD:214763 15/107 (14%)
IBR <976..1014 CDD:279784 18/46 (39%)
ankib1XP_012821068.1 ANK repeat 47..77 CDD:293786
Ank_2 50..176 CDD:372319
ANK repeat 79..143 CDD:293786
ANK repeat 145..176 CDD:293786
RING-HC_RBR_ANKIB1 333..389 CDD:319688 18/61 (30%)
RING-HC finger (C3HC4-type) 334..384 CDD:319688 17/53 (32%)
IBR 403..476 CDD:366672 15/104 (14%)
IBR <519..553 CDD:366672 17/32 (53%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469819at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.