DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mat1 and mnat1

DIOPT Version :9

Sequence 1:NP_610605.1 Gene:Mat1 / 36130 FlyBaseID:FBgn0024956 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_001017138.1 Gene:mnat1 / 549892 XenbaseID:XB-GENE-876260 Length:309 Species:Xenopus tropicalis


Alignment Length:312 Identity:164/312 - (52%)
Similarity:229/312 - (73%) Gaps:8/312 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDDQACPRCKTTKYRNPSLKLMVNVCGHTLCESCVDLLFLKGSGACPECMVPLRRNNFRVQLFED 65
            ||||.||||||||||||||||||||||||||||||:|||::|||:|.||..|||::|||||||||
 Frog     1 MDDQGCPRCKTTKYRNPSLKLMVNVCGHTLCESCVELLFVRGSGSCQECNTPLRKSNFRVQLFED 65

  Fly    66 PMVEKEVDIRRRILRDYNKREEDFASLAEYNDYLEEIEDIVYNLCNNIDIIETNKRIEAYKRDNR 130
            |.::|||:||::||:.||||||||.||.||||:||:||:||:||.||:|:..|.::|:.|:::|:
 Frog    66 PTIDKEVEIRKKILKIYNKREEDFPSLREYNDFLEDIEEIVFNLTNNVDLDNTRRKIDMYQKENK 130

  Fly   131 EVIQRNKTRVGRDEYALEEMLELEKVQEEARRKELEELENEHKKKKARDKQALIEELMYSGKDAA 195
            :.|||||.::.|::..|||.|||||.:.|.||..|::.|...:..|.::||.|:::|..|...|:
 Frog   131 DTIQRNKIKMTREQEELEEALELEKHENEQRRLYLQKEEQLQQMMKRKNKQELLDQLETSHLPAS 195

  Fly   196 QIVTEFAEKAEKQREEEKQLPPPKP--ANEFSTGIKFGQTADPSLLPVPKSEEGPLFVYEPLVPF 258
            .::   |:...:..:.|.|:..|||  .:.||||||.|...  :.:||.|.||. |:.|:|:...
 Frog   196 ILL---AQHKGRSVQVEMQVEKPKPFKTDTFSTGIKKGHHI--ASVPVTKIEEA-LYQYQPIHIE 254

  Fly   259 SEGPAMPPTNEIVSRGYIAHIRAETPQENAGGFTSALACERALQEALQGLYY 310
            :.||.:||...:..:||:.|:||.:||:.|||:.|:|||.||||:|..||::
 Frog   255 TYGPQLPPIEMLGRQGYLNHVRAASPQDLAGGYISSLACHRALQDAFSGLFW 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mat1NP_610605.1 cdk7 1..313 CDD:129661 164/312 (53%)
RING 3..47 CDD:302633 38/43 (88%)
CDC37_N 66..175 CDD:296150 56/108 (52%)
Seryl_tRNA_N 127..215 CDD:299883 29/87 (33%)
mnat1NP_001017138.1 cdk7 1..309 CDD:129661 164/312 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 175 1.000 Domainoid score I3612
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H1821
Inparanoid 1 1.050 329 1.000 Inparanoid score I2416
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1454155at2759
OrthoFinder 1 1.000 - - FOG0005635
OrthoInspector 1 1.000 - - oto102699
Panther 1 1.100 - - LDO PTHR12683
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X5285
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.160

Return to query results.
Submit another query.