DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7220 and UBC16

DIOPT Version :9

Sequence 1:NP_001097261.1 Gene:CG7220 / 36129 FlyBaseID:FBgn0033544 Length:190 Species:Drosophila melanogaster
Sequence 2:NP_565110.1 Gene:UBC16 / 843880 AraportID:AT1G75440 Length:161 Species:Arabidopsis thaliana


Alignment Length:165 Identity:78/165 - (47%)
Similarity:101/165 - (61%) Gaps:7/165 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 VSKCGKPLQLDNSR-WERRLHKELMSLIKEPPPGVTIDTESVQQNLSEWKINIKGFEGTLYEGED 92
            :|..|.|.:...|: ...||.|||:.....||.|.   ...|..||..|.|.:.|..||||..:.
plant     1 MSSSGAPSRKTLSKIATNRLQKELVEWQMNPPTGF---KHKVTDNLQRWIIEVIGAPGTLYANDT 62

  Fly    93 FQLLFKFNNKYPFDSPEVTFIGTNIPVHPHVYSNGHICLSILTEDWSPALSVQSVCLSIASMLSS 157
            :||...|...||.:||:|.|:.. .|:|||:||||||||.||.:.||||::|.|:|:||.|||||
plant    63 YQLQVDFPEHYPMESPQVIFLHP-APLHPHIYSNGHICLDILYDSWSPAMTVSSICISILSMLSS 126

  Fly   158 CREKKRPPDNTIYVKTC--NKNPKKTKWWYHDDSV 190
            ..||:||.||..|||.|  .::||:|:||:|||.|
plant   127 STEKQRPTDNDRYVKNCKNGRSPKETRWWFHDDKV 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7220NP_001097261.1 UQ_con 46..187 CDD:278603 70/142 (49%)
UBC16NP_565110.1 UQ_con 19..158 CDD:395127 70/142 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 132 1.000 Domainoid score I1663
eggNOG 1 0.900 - - E2759_KOG0427
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H10119
Inparanoid 1 1.050 154 1.000 Inparanoid score I1683
OMA 1 1.010 - - QHG55135
OrthoDB 1 1.010 - - D1522577at2759
OrthoFinder 1 1.000 - - FOG0002332
OrthoInspector 1 1.000 - - otm3321
orthoMCL 1 0.900 - - OOG6_102995
Panther 1 1.100 - - O PTHR24068
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1538
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.