DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7220 and ATUBC2-1

DIOPT Version :9

Sequence 1:NP_001097261.1 Gene:CG7220 / 36129 FlyBaseID:FBgn0033544 Length:190 Species:Drosophila melanogaster
Sequence 2:NP_564493.1 Gene:ATUBC2-1 / 841072 AraportID:AT1G45050 Length:161 Species:Arabidopsis thaliana


Alignment Length:177 Identity:79/177 - (44%)
Similarity:102/177 - (57%) Gaps:20/177 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LTEPKEPKTPPVSK--CGKPLQLDNSRWERRLHKELMSLIKEPPPGVTIDTESVQQNLSEWKINI 80
            :|....|....:||  |            .||.|||......||.|.   ...|..||.:|.|::
plant     1 MTSSSAPSRKALSKIAC------------NRLQKELSEWQLNPPTGF---RHKVTDNLQKWTIDV 50

  Fly    81 KGFEGTLYEGEDFQLLFKFNNKYPFDSPEVTFIGTNIPVHPHVYSNGHICLSILTEDWSPALSVQ 145
            .|..||||..|.:||..:|...||.::|:|.|: :..|.|||:||||||||.||.:.||||::|.
plant    51 TGAPGTLYANETYQLQVEFPEHYPMEAPQVVFV-SPAPSHPHIYSNGHICLDILYDSWSPAMTVN 114

  Fly   146 SVCLSIASMLSSCREKKRPPDNTIYVKTC--NKNPKKTKWWYHDDSV 190
            |||:||.|||||...|:||.||..|||.|  .::||:|:||:|||.|
plant   115 SVCISILSMLSSSPAKQRPADNDRYVKNCKNGRSPKETRWWFHDDKV 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7220NP_001097261.1 UQ_con 46..187 CDD:278603 70/142 (49%)
ATUBC2-1NP_564493.1 UQ_con 19..158 CDD:278603 70/142 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 132 1.000 Domainoid score I1663
eggNOG 1 0.900 - - E2759_KOG0427
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 154 1.000 Inparanoid score I1683
OMA 1 1.010 - - QHG55135
OrthoDB 1 1.010 - - D1522577at2759
OrthoFinder 1 1.000 - - FOG0002332
OrthoInspector 1 1.000 - - otm3321
orthoMCL 1 0.900 - - OOG6_102995
Panther 1 1.100 - - O PTHR24068
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1538
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.840

Return to query results.
Submit another query.