DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7220 and FUS9

DIOPT Version :9

Sequence 1:NP_001097261.1 Gene:CG7220 / 36129 FlyBaseID:FBgn0033544 Length:190 Species:Drosophila melanogaster
Sequence 2:NP_566459.2 Gene:FUS9 / 820557 AraportID:AT3G13550 Length:182 Species:Arabidopsis thaliana


Alignment Length:146 Identity:45/146 - (30%)
Similarity:69/146 - (47%) Gaps:14/146 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 RRLHKELMSLIKEPPPGVTIDTESVQQNLSEWKINIKGFEGTLYEGEDFQLLFKFNNKYPFDSPE 109
            :|:.:|:..|..:|||..:...:.  .||..|...|.|..||.|||..|.|...|.:.|||..|:
plant    39 KRIQREMAELNIDPPPDCSAGPKG--DNLYHWIATIIGPSGTPYEGGIFFLDIIFPSDYPFKPPK 101

  Fly   110 VTFIGTNIPVHPHVYSNGHICLSILTEDWSPALSVQSVCLSIASMLSSCREKKRPPDNT------ 168
            :.| .|.| .|.:|.:.|.:.::||.:.|||||::..|..:|.|:..    |..|....      
plant   102 LVF-KTRI-YHCNVDTAGDLSVNILRDSWSPALTITKVLQAIRSIFL----KPEPYSPALPVIAR 160

  Fly   169 IYVKTCNKNPKKTKWW 184
            :|:....|:.:..|.|
plant   161 LYLTDREKHDEVAKEW 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7220NP_001097261.1 UQ_con 46..187 CDD:278603 45/145 (31%)
FUS9NP_566459.2 UBCc 39..177 CDD:238117 45/146 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.