DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7220 and ube2a

DIOPT Version :9

Sequence 1:NP_001097261.1 Gene:CG7220 / 36129 FlyBaseID:FBgn0033544 Length:190 Species:Drosophila melanogaster
Sequence 2:NP_958430.1 Gene:ube2a / 797853 ZFINID:ZDB-GENE-030616-72 Length:152 Species:Danio rerio


Alignment Length:138 Identity:47/138 - (34%)
Similarity:71/138 - (51%) Gaps:10/138 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 RRLHKELMSLIKEPPPGVTIDTESVQQNLSEWKINIKGFEGTLYEGEDFQLLFKFNNKYPFDSPE 109
            |||.::...|.::||.||:  ....:.|:..|...|.|.|||.:|...|:|..:|..:||...|.
Zfish     7 RRLMRDFKRLQEDPPAGVS--GAPSENNIMVWNAVIFGPEGTPFEDGTFKLTIEFTEEYPNKPPT 69

  Fly   110 VTFIGTNIPVHPHVYSNGHICLSILTEDWSPALSVQSVCLSIASMLSSCREKKRP--PDNTIYVK 172
            |.|:....  ||:||::|.|||.||...|||...|.|:..||.|:|    ::..|  |.|:...:
Zfish    70 VRFVSKMF--HPNVYADGSICLDILQNRWSPTYDVSSILTSIQSLL----DEPNPNSPANSQAAQ 128

  Fly   173 TCNKNPKK 180
            ...:|.::
Zfish   129 LYQENKRE 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7220NP_001097261.1 UQ_con 46..187 CDD:278603 46/137 (34%)
ube2aNP_958430.1 UQ_con 8..145 CDD:395127 46/137 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.